KEGG   Acidovorax citrulli: Aave_1239Help
Entry
Aave_1239         CDS       T00451                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aav  Acidovorax citrulli
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aave_1239
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aave_1239
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Aave_1239
Enzymes [BR:aav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Aave_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1363831..1365276
Genome map
AA seq 481 aa AA seqDB search
MRYLSTRGHADRKRFCEILLEGLAPDGGLYLPEHYPQIDDAALTRLRAAYHEQGYAELAF
QILSLYIDDIPAADLKRLCEKTYTAEVFGTGEIVPLRHLENSLWLEALSNGPTLAFKDMA
MQLLGNLFEYELGRRGEELNILGATSGDTGSAAEYAMRGKRGIRVFMTSPHGRMSAFQQA
QMFSLQDANIFNIAIEGVFDDCQDIVKAVSNDLEFKRRFKIGTVNSINWARLLAQVVYYF
AGYVQATESNDQKVSFTVPSGNFGNVCAGHVARMMGLPIDKLVVATNENDVLDEFFRTGI
YRVRGSADTHETSSPSMDISKASNFERFVFDLLGRDAEATRRLFGEAVVREGRFDLSGDP
RFAEAASRYGFVSGRSTHADRIATIRDTFQRFGITIDTHTADGVKVAREHTEPGVPMLVL
ETALPIKFAETIQEALGHAPERPAKFDGIERLPKRVQVMPADVDLVKAYITRHCDGTAAA
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcgatacctctccacacgcggccacgcggaccgcaagcgcttctgcgagatcctgctc
gaaggcctcgcgcccgacggcgggctgtacctgcccgagcattacccgcagatcgacgac
gccgcgctcacgcggctgcgcgcggcctaccacgagcagggctacgcggagctggcgttc
cagatcctgtcgctctacatcgacgacattccggcggccgacctgaagcgcctgtgcgag
aagacgtacaccgccgaggtgttcggcacgggcgagatcgtgccgctgcgccacctggag
aacagcctgtggctggaggcgctctccaacggccccacgctcgcgttcaaggacatggcg
atgcagctgctgggcaacctgttcgagtacgaactgggccggcgcggcgaagagctcaac
atcctgggcgcgaccagcggcgataccggcagcgcggccgagtacgcgatgcgcggcaag
cgcggcatccgcgtgttcatgacgagcccgcacggccgcatgagcgccttccagcaggcg
cagatgttcagcctgcaggacgcgaacatcttcaacatcgccatcgaaggcgtgttcgac
gactgccaggacatcgtcaaggccgtgagcaacgacctggagttcaagcgccgcttcaag
atcggcacggtgaactcgatcaactgggcgcggctgctcgcccaggtggtgtattacttc
gcgggttacgtgcaggccaccgagtcgaacgaccagaaggtcagcttcacggtgccgtcg
ggcaatttcgggaacgtgtgcgcgggccacgtggcgcgcatgatgggcctgcccatcgac
aagctcgtggtggcgaccaacgagaacgacgtgctcgacgagttcttccgcacgggcatc
taccgcgtgcgcggcagcgccgatacgcacgagacgtccagcccgtcgatggacatcagc
aaggccagcaatttcgagcgcttcgtgttcgacctgctgggccgcgacgcggaggccacg
cgccggctgttcggcgaggccgtggtgcgcgagggccgcttcgacctcagcggcgatccg
cgcttcgccgaggccgcgtcgcgctacggcttcgtgagcgggcgcagcacgcacgcggac
cgcatcgcgaccatccgcgacaccttccagcgcttcggcatcacgatcgacacgcacacc
gccgacggggtgaaggtggcgcgcgagcacaccgagccgggcgtgccgatgctggtgctg
gaaaccgccctgccgatcaagttcgccgagacgatccaggaggctctgggccatgctccc
gaacgccccgcgaagttcgacggcatcgagcgcctgcccaagcgcgtgcaggtgatgccg
gccgacgtggatctggtgaaggcctacatcacgcgccactgcgacgggaccgccgcagcg
gcctga

DBGET integrated database retrieval system