KEGG   Acidovorax citrulli: Aave_1261Help
Entry
Aave_1261         CDS       T00451                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aav  Acidovorax citrulli
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aave_1261 (tpiA)
   01230 Biosynthesis of amino acids
    Aave_1261 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_1261 (tpiA)
   00051 Fructose and mannose metabolism
    Aave_1261 (tpiA)
   00562 Inositol phosphate metabolism
    Aave_1261 (tpiA)
Enzymes [BR:aav01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Aave_1261 (tpiA)
Exosome [BR:aav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Aave_1261 (tpiA)
  Exosomal proteins of bladder cancer cells
   Aave_1261 (tpiA)
  Exosomal proteins of melanoma cells
   Aave_1261 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1386478..1387233
Genome map
AA seq 251 aa AA seqDB search
MTKKKLIAGNWKMNGTLGANAALLQALRGGLEAGAYQNVDVAVAVPAAYLAQVQGLVEGS
AIALAAQDVSRHEAGAYTGEVSAAMLQEFGVRYVLVGHSERRQYHGETDEQVAEKAQRAL
AAGITPVVCVGETLAEREAGQTEAVVKRQLAAVIHLNGHCISETVVAYEPVWAIGTGRTA
TPEQAQQVHAVLRAQLAAASEHADRIRLLYGGSMNAANAAALLAQPDIDGGLVGGASLKA
QDFLQIIAAAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaagaaactcatcgcgggcaactggaagatgaatggcaccctgggtgccaat
gccgcgctgctgcaggcgctgcgcggcggcctcgaggcgggcgcgtaccagaacgtggat
gtggccgtggcggtgccggcggcctacctcgcgcaggtgcagggcctggtcgaaggctcg
gccatcgcgctggcggcgcaggacgtgtcccggcacgaagcgggcgcctacacgggcgag
gtctccgcggcgatgctccaggaattcggcgtgcgctacgtgctggtcgggcattccgag
cgccgccagtaccacggcgagaccgacgagcaggtggccgagaaggcgcagcgcgcactg
gccgccggcatcacgccggtggtatgcgtgggcgagacgctggccgagcgcgaggccgga
cagaccgaagccgtggtcaagcgccagctggccgcggtcatccacctgaacggtcattgc
atcagcgagaccgtggtggcctacgagcccgtctgggccatcggcaccggtcgcaccgcc
acgcccgagcaggcacagcaggtgcatgccgtgctgcgcgcgcagctcgcggctgccagc
gagcatgcggaccgcatccgcctgctctacggcggcagcatgaacgccgcgaacgcggcc
gcattgctggcccagcccgacatcgacggaggcctcgtgggcggcgcatcgctcaaggcc
caggactttttgcagatcatcgcagcggccgcctga

DBGET integrated database retrieval system