KEGG   Acidovorax citrulli: Aave_1261Help
Entry
Aave_1261         CDS       T00451                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aav  Acidovorax citrulli
Pathway
aav00010  Glycolysis / Gluconeogenesis
aav00051  Fructose and mannose metabolism
aav00562  Inositol phosphate metabolism
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
aav01200  Carbon metabolism
aav01230  Biosynthesis of amino acids
Module
aav_M00002  Glycolysis, core module involving three-carbon compounds
aav_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_1261
   00051 Fructose and mannose metabolism
    Aave_1261
   00562 Inositol phosphate metabolism
    Aave_1261
Enzymes [BR:aav01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Aave_1261
Exosome [BR:aav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Aave_1261
  Exosomal proteins of bladder cancer cells
   Aave_1261
  Exosomal proteins of melanoma cells
   Aave_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABM31852
JGI: Aave1261
UniProt: A1TLL4
Position
1386478..1387233
Genome map
AA seq 251 aa AA seqDB search
MTKKKLIAGNWKMNGTLGANAALLQALRGGLEAGAYQNVDVAVAVPAAYLAQVQGLVEGS
AIALAAQDVSRHEAGAYTGEVSAAMLQEFGVRYVLVGHSERRQYHGETDEQVAEKAQRAL
AAGITPVVCVGETLAEREAGQTEAVVKRQLAAVIHLNGHCISETVVAYEPVWAIGTGRTA
TPEQAQQVHAVLRAQLAAASEHADRIRLLYGGSMNAANAAALLAQPDIDGGLVGGASLKA
QDFLQIIAAAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaagaaactcatcgcgggcaactggaagatgaatggcaccctgggtgccaat
gccgcgctgctgcaggcgctgcgcggcggcctcgaggcgggcgcgtaccagaacgtggat
gtggccgtggcggtgccggcggcctacctcgcgcaggtgcagggcctggtcgaaggctcg
gccatcgcgctggcggcgcaggacgtgtcccggcacgaagcgggcgcctacacgggcgag
gtctccgcggcgatgctccaggaattcggcgtgcgctacgtgctggtcgggcattccgag
cgccgccagtaccacggcgagaccgacgagcaggtggccgagaaggcgcagcgcgcactg
gccgccggcatcacgccggtggtatgcgtgggcgagacgctggccgagcgcgaggccgga
cagaccgaagccgtggtcaagcgccagctggccgcggtcatccacctgaacggtcattgc
atcagcgagaccgtggtggcctacgagcccgtctgggccatcggcaccggtcgcaccgcc
acgcccgagcaggcacagcaggtgcatgccgtgctgcgcgcgcagctcgcggctgccagc
gagcatgcggaccgcatccgcctgctctacggcggcagcatgaacgccgcgaacgcggcc
gcattgctggcccagcccgacatcgacggaggcctcgtgggcggcgcatcgctcaaggcc
caggactttttgcagatcatcgcagcggccgcctga

DBGET integrated database retrieval system