KEGG   Acidovorax citrulli: Aave_1412Help
Entry
Aave_1412         CDS       T00451                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
aav  Acidovorax citrulli
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1551950..1553500)
Genome map
AA seq 516 aa AA seqDB search
MADRPPSEIARETLKQLAARRLVPTPDNYQALYEEIAGTRTAPTFPDAQLRHILRVLPGQ
TPAQKRLLGQFETAIEQADWSMLQGVLVGYANLGLHAGGATPVETAPAPLTGGPTGTATV
LPEDMAEQLARLVDNTLPALGEDDARVHELAAQLTHFLRQPGPPVSTLVLMLNNFSYRLS
FATEDQAAIRAGLLTLLHMVFENISVLSKDDHWLQGQAEALKAASTPPLTLRRLDDVQRR
LKDVIFKQNEARERSVQAQQQMKELLATFIERLAQITASSSTYHEKMERCAEQIGQATSL
DQITPLLEEVMGATRAMALDTRLTRDELQELRERSEARHAEIAKLQEELDRASAQARHDP
LTGSLNRKGLDEALEREVARALRNDAPLCVALLDLDNFKAINDRLGHTGGDEALKHLAGV
TREVMRPQDQLARYGGEEFVIILPDTALAQGVEAMARLQRELTTRYFLKDQEKVLITFSA
GVAQVAPQETTVEAIRRADQGMYLAKRSGKNRVMAA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccgccccccttcagagatcgcgcgagaaaccctcaaacagctggcggcccgc
cgcctcgtgcccacgccggacaactaccaggcgctgtacgaggagatcgccggcacgcgc
acggccccgaccttccccgatgcgcaactgcgccacatcctgcgggtgctccccggccag
acgcccgcccagaagcggctgctcggccagttcgagacggccatcgaacaggcggactgg
tcgatgctgcagggcgtgctggtgggttatgcgaacctcggtctgcatgccggtggcgcc
acccccgtggagacggccccggcaccgctgacgggcggaccgacgggcaccgccacggtg
ctgcccgaagacatggcggagcaactggcccgtctggtcgacaacacgctgccggcgctg
ggcgaggacgacgcgcgcgtccatgaactggcggcgcagctcacgcatttcctgcgccag
cccggaccgccggtttccacgctggtgctgatgctcaacaacttcagctaccgcctctcc
ttcgcgacagaggaccaggcggcgatccgcgccggcctgctgaccctgctgcacatggtg
ttcgagaacatctctgtactgagcaaggacgaccactggctgcaggggcaggccgaggcc
ctcaaggcggcctccacgccgccgctcacgctgcggcggctggacgacgtgcagcgccgg
ctcaaggacgtgatcttcaagcagaacgaggcacgcgagcgctccgtgcaggcgcagcag
cagatgaaggaactgctggccacgttcatcgagcggctcgcgcagatcaccgcgtccagc
agcacgtaccacgagaagatggagcgctgcgccgagcagatcgggcaggccacgagcctg
gaccagatcacgccgctgctcgaggaagtgatgggagcgacccgtgccatggcgctcgac
acgcgcctgacgcgcgacgagctgcaggagctgcgcgagcgctccgaggcccggcacgcg
gagatcgccaagctgcaggaggagctggaccgggccagcgcccaggcgcggcacgatccg
ctgaccggctcgctgaaccgcaagggcctggacgaggcgctggagcgcgaagtggcccgt
gcgctgcgcaacgacgcgccgctgtgcgtcgcgctgctggacctggacaatttcaaggcc
atcaacgaccggctggggcatacgggcggggacgaggcgctcaagcacctggcaggcgtg
acgcgcgaggtgatgcgtccgcaggaccagctcgcccgctacgggggcgaggagttcgtg
atcatcctgccggacaccgcgctggcccagggcgtggaggccatggcccgcctgcagcgc
gagctgaccacgcgctacttcctcaaggaccaggaaaaggtgctcatcaccttcagcgcc
ggcgtggcgcaggtcgcgccgcaggagacgacggtggaagcgatccggcgggcggaccag
gggatgtacctcgccaagcgctcgggcaagaaccgtgtcatggcggcctga

DBGET integrated database retrieval system