KEGG   Acidovorax citrulli: Aave_1415Help
Entry
Aave_1415         CDS       T00451                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aav  Acidovorax citrulli
Brite
Enzymes [BR:aav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Aave_1415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1555553..1556338
Genome map
AA seq 261 aa AA seqDB search
MQRRPGFPARLDMPPAPGAPRAPAPSRPPLPGGAPAAGPVPHGLGLDSAAVRARMVQRLA
AGGITSPAVLQAMGSVERHRFVDTALVNQAYEDTSLPIGLGQTISKPSIVARMTELLLGA
EGARAGGLGRVLEIGTGCGYQAAVLARLAREVYTIERLRALHEKARDNLRPWRLATVHLI
LGDGMVGYAKGAPYAAIIAAAGGETIPDAWVQQLAVGGRLVAPMAAAGGRQVLVVIDRTP
HGLQQSTLEAVHFVPLKSGIA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggcggcccggttttcccgcccgtctcgacatgccgcccgcgcccggtgcgcca
cgcgctccggcgccctcgcgccccccgctgcccggcggcgctccggcggccgggcccgtg
ccgcacggcctgggcctggattcggccgccgtgcgcgcgcgcatggtgcagcgcctcgcc
gccggcgggatcacgtcacccgccgtgctccaggccatgggctcggtggagcggcaccgt
ttcgtggacaccgcgctcgtcaaccaggcctacgaggacaccagcctgcccatcgggctc
gggcagacgatctccaagcccagcatcgtggcccgcatgaccgagctgctgctgggggcc
gagggcgcccgtgcgggcggcctggggcgcgtgctggaaatcggcaccggatgcggctac
caggccgcggtgctcgcccggctggcgcgggaggtgtacaccatcgagcggctgcgcgcg
ttgcatgagaaggcccgcgacaatctgcgtccctggcggctggccaccgtgcacctgata
ctgggcgacggcatggtcggctacgcgaagggcgcgccctatgccgccatcatcgccgcc
gcgggcggtgaaaccattcccgacgcctgggtccaacagctcgccgtgggagggcgcctc
gtcgcccccatggccgcggcgggcgggcggcaggtcctcgtcgtgatcgacaggactccc
cacgggcttcagcagagcacgttggaggccgtacattttgtccccctaaaatcggggatt
gcctga

DBGET integrated database retrieval system