KEGG   Acidovorax citrulli: Aave_1499Help
Entry
Aave_1499         CDS       T00451                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aav  Acidovorax citrulli
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aave_1499
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_1499
   00620 Pyruvate metabolism
    Aave_1499
   00640 Propanoate metabolism
    Aave_1499
  Energy metabolism
   00680 Methane metabolism
    Aave_1499
Enzymes [BR:aav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Aave_1499
Lipid biosynthesis proteins [BR:aav01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Aave_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1663925..1665919
Genome map
AA seq 664 aa AA seqDB search
MSASSSTIESVLVENRVFPPPAACEQAARVSGMAGYEALCSEAERDFEGFWARLARENVQ
WTRPFTRTLDESNAPFFQWFADGELNASANCLDRHIGTPVENKTAIVFEADDGAVTKVTY
RELLERVGRFANALQAEGVKKGDRVLIYMPMTIEGVVAMQACARIGATHSVVFGGFSAKA
LQERIIDAGAVAVITANYQMRGGKELPLKAIVDEGIAMGGCESIRSILVFQRTPTACNMV
AGRDKTFDEALAGQGAECAPVPVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWARLTMD
WTFDLKPEDVFWCTADIGWITGHTYVAYGPLAAGATQVVFEGVPTYPDAGRFWQMIERHK
VSIFYTAPTAIRSLIKAADSDEKVHPKNWDLSSLRILGSVGEPINPEAWMWYHRNVGGER
CPIVDTFWQTETGGHVITPLPGATPLVPGSCTLPLPGITAAIVDESGNDIPNGTGGILVI
KRPWPSMIRTIWNDPERFKKSYFPEELKGYYLAGDGAVRSADRGYFRITGRIDDVLNVSG
HRMGTMEIESALVAKTDLVAEAAVVGRPDDLTGEAICAFVVLKRPRPTGDEAKAIAKELR
DWVAREIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSIAKGEAITQDTSTLENPAILDQL
AQAN
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgtcatcgtccacgatcgaatccgtgctggtggaaaaccgcgtgttccccccg
cccgccgcctgcgagcaagccgcccgcgtgtccggcatggccggctacgaggccctgtgc
tccgaggccgagcgtgatttcgagggcttctgggcgcgcctggcgcgcgagaacgtgcag
tggaccaggcccttcacccgcacgctcgacgagtccaacgccccgttcttccagtggttc
gccgacggcgagctgaacgccagcgccaactgcctggaccgccacatcggcacgccggtc
gagaacaagaccgcgatcgtcttcgaggccgacgacggggccgtgacgaaggtcacctac
agggaactgctggagcgcgtgggccgcttcgccaacgccctccaggccgagggcgtgaag
aagggcgaccgcgtgctgatctacatgcccatgaccatcgagggcgtggtggccatgcag
gcctgcgcgcgcatcggcgccacccacagcgtggtgttcggcggcttctcggccaaggcg
ctgcaggagcgcatcatcgacgcgggcgcggtggccgtgatcaccgccaactaccagatg
cgcggcggcaaggagttgccgctgaaggccatcgtggacgaaggcatcgccatgggcggc
tgcgagtcgatccgcagcatcctcgtcttccagcgcacgcccacggcctgcaacatggtg
gcgggccgcgacaagaccttcgatgaagcgctggccggccagggggccgagtgcgccccc
gtgcccgtgggcgcggagcacccgctcttcatcctctacaccagcggttcgaccggcaag
cccaagggcgtgcagcattccaccggcggctacctgctgtgggccaggctcacgatggac
tggactttcgacctcaagcccgaggacgtgttctggtgcacggccgacatcggctggatc
accggccacacctacgtggcgtacggcccgctcgccgccggcgccacgcaggtcgtgttc
gagggcgtgcccacctacccggacgccggccgcttctggcagatgatcgagcgccacaag
gtctcgatcttctacaccgcgcccacggccatccgctccctcatcaaggcggccgattcg
gacgagaaggtgcatccgaagaactgggacctctcgagcctgcgcatcctgggcagcgtg
ggcgaacccatcaatccggaggcctggatgtggtaccaccggaacgtgggcggcgagcgc
tgccccatcgtggacaccttctggcagaccgaaaccggcggccatgtcatcaccccgctg
ccgggtgccacgccgctggtgccgggctcctgcacgctgccgctgcccggcatcaccgcc
gccatcgtcgatgaatccggcaacgacatccccaacggcacgggcgggatcctggtcatc
aagcgcccctggcccagcatgatccgcaccatctggaacgatccggagcgcttcaagaag
agctacttccccgaagagctcaagggctactacctggcgggcgacggcgcggtgcgctcg
gccgaccgtggctacttccgcatcaccggccgcatcgacgacgtgctgaacgtctcgggc
caccgcatgggcacgatggagatcgaatcggccctggtcgccaagaccgacctcgtggcc
gaggccgccgtggtgggccgccccgacgacctgaccggcgaggccatctgcgccttcgtc
gtcttgaagcgaccgcgccccaccggcgacgaggccaaagcgatcgccaaggaactgcgc
gactgggtggccagggagatcggcccgatcgccaagccgaaggacatccgcttcggcgac
aacctgcccaagacccgcagcggcaagatcatgcgccgcctgctgcgctccatcgccaag
ggggaggcgatcacgcaggacaccagcacgcttgagaatccggcgatcctggatcagctg
gcccaggccaactga

DBGET integrated database retrieval system