KEGG   Acidovorax citrulli: Aave_1829Help
Entry
Aave_1829         CDS       T00451                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
aav  Acidovorax citrulli
Pathway
aav00900  Terpenoid backbone biosynthesis
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Aave_1829
Enzymes [BR:aav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Aave_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: ABM32413
JGI: Aave1829
UniProt: A1TN75
Position
1982450..1983628
Genome map
AA seq 392 aa AA seqDB search
MKQRLTVLGSTGSIGTSTLDVVARHPGRYEIFALSAATQVDAMAAQCLRFGPRYAVMASP
EHARALREALAAQGSSTEVMDTPDALQAISAHPEVDVVMAAIVGAAGLAPCLAAARAGKR
LLLANKEALVVGGEVFMSAVREGGATLLPIDSEHSAIFQCLPEDASSWPRRVDHILLTAS
GGPFRTREPATLRDVTPEQACAHPNFSMGRKISVDSATMMNKALEVIEARWLFNLAPEQI
QVVIHPQQIIHSMVQFKDASVLAQLGTPDMRVPIACGLAWPERIESGTPRLDFRSLAALT
FEEADATRFPGLHLSWQALRAAPGTTAVLNAANEVAVASFLERRIRFDQIHRLNLATLEA
VSPSNPDSLCALLDLDAQARSVARHRAERLAA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacgccttaccgtcctgggttccaccggctccatcggaaccagtaccctggac
gtggtcgcgcgccaccccggccgctacgagatcttcgcgctgagcgccgccacgcaggtg
gacgccatggcggcgcagtgcctgcgctttggtccgcgctacgcggtcatggcgagcccg
gagcatgcccgcgcgctgcgggaggcactggccgcgcaggggtcgtccaccgaggtgatg
gacacccccgatgccctgcaggcgatctccgcccatcccgaggtggacgtggtcatggcg
gccatcgtcggcgccgccgggctcgctccctgcctggccgccgcgcgcgcgggcaagcgc
ctgctgctggcgaacaaggaagcgctggtcgtgggcggcgaggtgttcatgtccgcggtg
cgcgagggcggcgccacgctgctgcccatcgacagcgagcattccgccatcttccagtgc
ctgccggaggatgcgtcctcctggccgcggcgcgtggaccacatcctgctcaccgcgtcc
ggcggcccgttccgcacgcgcgagcccgccaccctgcgcgacgtgacacccgagcaggcc
tgtgcccatcccaacttctccatggggcgcaagatctcggtggattccgcgaccatgatg
aacaaggcgctggaagtgatcgaggcgcgctggctgttcaatctggcgccggaacagatc
caggtggtcatccatccgcagcagatcatccattcgatggtgcagttcaaggacgcctcg
gtgctggcccaactgggcacgcccgacatgcgcgtgcccatcgcctgcggcctcgcctgg
cccgagcgcatcgagagcggcacgccccggctcgatttccgcagcctggccgccctgacc
ttcgaggaagccgacgccacgcgctttcccgggctgcacctgtcgtggcaggccctgcgt
gccgcgccgggcaccaccgcggtgctcaatgcggccaacgaggtggcggtggcgtcgttc
ctggaacgccgcatccgcttcgaccagatccaccggctgaatcttgcaactctggaggcg
gtatcgccctccaacccggactcgctgtgcgcattgctcgacctcgacgcccaggcgcgt
tcggtcgcgcggcaccgggcagagcggctcgcggcctga

DBGET integrated database retrieval system