KEGG   Acidovorax citrulli: Aave_1991Help
Entry
Aave_1991         CDS       T00451                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aav  Acidovorax citrulli
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Aave_1991
   00052 Galactose metabolism
    Aave_1991
   00500 Starch and sucrose metabolism
    Aave_1991
   00520 Amino sugar and nucleotide sugar metabolism
    Aave_1991
Enzymes [BR:aav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Aave_1991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2159395..2160312)
Genome map
AA seq 305 aa AA seqDB search
MIQLPTEESSMSDNSAIRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYA
AGIRHMIFVTGRSKRAIEDHFDTAYELENELEAAGKKDLLQLVRSVAPNDMDCAFVRQPR
SLGLGHAVLCAEPLVGREPFAVLLADDLMVGPPGGQPVMAQMAAAFRKQGRSLLAVQEVP
QDQVRRYGIVAGEPAGGPLIRIDRIVEKPAPEEAPSRMGVAGRYILTPGVFDEIRNQPQG
VGGEIQLTDAIARLMAREAVYAFRYEGKRYDCGSKEGFLEATVELALQHPQVGAAFREYL
KTVEI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatccaacttccaaccgaggaatcttcaatgagcgacaactccgcgatccgcaaagcc
gtcttccccgtggccggcctgggcacccgcttcctgcccgccacgaaggcatcccccaag
gagatgctgccggtggtggacaagccgctgatccagtacgccgtcgaagaggcctacgcg
gccggcatccgccacatgatcttcgtcaccggccgcagcaagcgcgccatcgaggaccat
ttcgacaccgcctacgaactcgagaacgagctggaagcggccggcaagaaggacctgctg
cagctcgtgcgctcggtcgcgcccaacgacatggactgcgccttcgtgcgccagccgcgt
tccctgggcctcggccatgccgtgctctgcgccgagccgctcgtgggccgcgaacccttc
gccgtgctgctcgccgacgacctgatggtgggaccgcccggcggccagcccgtcatggcc
cagatggcggccgccttccgcaagcagggccgctcgctgctggccgtgcaggaagtgccg
caggaccaggtccgccgctacggcatcgtggccggcgaacccgcgggcggcccgctgatc
cgcatcgaccgcatcgtcgagaagccggcccccgaagaagcgccctcgcgcatgggcgtg
gccggccgctacatcctcacgcccggcgtgttcgacgaaatccgcaaccagccccagggc
gtgggcggcgagatccagctcaccgacgcgatcgcccgcctcatggcccgcgaagccgtc
tatgccttccgctacgaaggcaagcgctacgactgcggcagcaaggaaggcttcctggaa
gccaccgtggaactggccctgcagcatccccaggtgggcgctgccttccgcgaatacctc
aagaccgtggaaatctga

DBGET integrated database retrieval system