KEGG   Acidovorax citrulli: Aave_2024Help
Entry
Aave_2024         CDS       T00451                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aav  Acidovorax citrulli
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Aave_2024
Enzymes [BR:aav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Aave_2024
Exosome [BR:aav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aave_2024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2204920..2206953)
Genome map
AA seq 677 aa AA seqDB search
MAFSRHGRAEAGFLVAFLPPRPLPGFHVPSNDPSLLTAHDAYLLREGTHARLYQSLGCHL
RRAEGVPVQEVRGADFAVWAPNAASVSVIGDWNGWNPEADPLLPRGDDSGVWEGFAPDAT
HGQAYKYRIVSRNGGRVLEKADPLAICSELPPRTASRIWDLDYTWSDGEWMASRGPRNAL
GAPMSIYEVHAGSWRRRDGQFMGYRELAHALGEYVQSMGFTHVELMPITEHPFYGSWGYQ
TTGYFAPTARYGTPQDFMYFVDHLHQRGIGVLLDWVPSHFPMDGHGLAEFDGTHLYEHAD
PRQGFHPEWNSAIFNYGRNEVRSFLISSGLFWIDKYHLDGLRVDAVASMLYLDYARKHGE
WVPNRHGGRENLEAIEFMRLLNRSLYRDHPDTVSIAEESTAWPMVSRPVEMNGLGFGMKW
NMGWMHDTLSYFKEDPVHRRYHHHKLTFSLVYAFNENFVLPLSHDEVVYGKGSLVNKMPG
DEWQQFANLRALFGLMWAHPGKKLLFMGGEFGQRREWTHEGELEWWVCDGPLHGGLQRMV
RELNRVLRSEPALHDIDFSPEGFQWVEADDADRSVIAFLRKPGAEAQRQGATPVLVVCNM
TPVPRENYLVGVPSAGYWRELFNSDAREFGGAGWGNLGGVEAAPVRSHHWAQSLCLTLPP
LSTLILRLEPARHAFPA
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggctttcagccgacacggtcgtgcggaagccggctttcttgttgcgttccttcctcca
cgaccccttccaggattccacgtgccgtccaacgatccctccctgctgaccgcccacgac
gcctacctgctgcgcgagggcacgcatgcgcgcctctaccagtcgctgggctgccacctg
cgccgcgcggaaggcgtgcccgtgcaggaggtgcgcggcgcggacttcgcggtatgggcc
ccgaacgcggcctcggtctcggtgatcggcgactggaacggctggaacccggaggccgac
ccgctgctcccccgcggcgacgacagcggcgtgtgggagggcttcgcgcccgatgccacc
cacgggcaggcttacaagtaccgcatcgtgtcgcgcaatggcggccgggtgctggaaaag
gcggacccgctggccatctgctccgagctgccgccgcgcaccgcatcgcgcatctgggac
ctcgactacacgtggagcgacggtgaatggatggcctcgcgcggcccgcgcaatgcgctg
ggcgccccgatgtcgatctacgaggtgcatgccggctcctggcgccgcagggacggccag
ttcatgggctaccgcgagctggcccatgcactgggcgagtatgtgcagtcgatgggcttc
acccacgtggagctgatgcccatcaccgagcatccgttctacggctcctggggctaccag
accaccggctacttcgcgcccacggcgcgctacggcacgccgcaggatttcatgtacttc
gtggaccacctgcaccagcgcggcatcggcgtgctgctggactgggtgccctcgcacttc
ccgatggacgggcacgggctggcggagttcgacggcacgcacctgtacgagcacgccgac
ccgcgccagggcttccatccggagtggaactcggccatcttcaactatggccgcaacgag
gtgcgcagcttcctcatctcctcgggcctgttctggatcgacaagtatcacctggacggc
ctgcgcgtggacgcggtggcgtccatgctctacctggactacgcacgcaagcatggcgaa
tgggtgcccaaccgccacggcgggcgcgagaatctggaggcgatcgagttcatgcggctg
ctcaaccgctcgctctaccgcgaccacccggacacggtgagcatcgccgaggaatccacc
gcctggcccatggtgtcgcgccccgtggaaatgaacgggctgggcttcggcatgaagtgg
aacatgggctggatgcacgacacgctgtcgtacttcaaggaagacccggtccaccgccgc
taccaccaccacaagctcacgttctcgctggtgtatgccttcaacgagaacttcgtgctg
ccgctctcgcacgacgaagtcgtctatggcaaggggtcgctcgtcaacaagatgccgggc
gacgaatggcagcagttcgccaacctgcgcgcgctgttcggcctgatgtgggcccacccc
ggcaagaaactgctcttcatgggcggcgagttcggccagcgccgcgaatggacgcacgag
ggcgagctcgaatggtgggtctgcgacggcccgctgcacggcggcctgcagcgcatggtg
cgcgagctcaaccgcgtgctgcgcagcgagccggccctgcacgacatcgatttctccccc
gaaggcttccagtgggtggaagccgacgacgccgaccgcagcgtgatcgccttcctgcgc
aaacccggcgccgaggcccagcgccagggcgccacgccggtgctggtggtctgcaacatg
acgccggtgccgcgagagaactacctcgtgggggtgccctccgccggctactggcgggaa
ctgttcaacagcgatgcccgcgagttcggcggcgccggctggggcaacctgggcggagtg
gaagccgcgcccgtgcgctcgcaccactgggcgcagtcgctgtgcctcacgctgccgccg
ctgtccaccctcatcctccgactggagcctgcacgccatgccttccccgcctga

DBGET integrated database retrieval system