KEGG   Acidovorax citrulli: Aave_2102Help
Entry
Aave_2102         CDS       T00451                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aav  Acidovorax citrulli
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Aave_2102
Enzymes [BR:aav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Aave_2102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2303147..2304637)
Genome map
AA seq 496 aa AA seqDB search
MAQLGSVGRAVALAASLLACGNVAWSYSISNGQVVDDAGQAVQLRGVNWFGFETGEHVVH
GLWARNWKDMIGQMQQQGFNAVRLPFCPRSLRGTGPGSIDYSRNPDLQGLNSQQILDKVV
QEISDRGMFVLLDHHTPDCQAISELWYTPAYSEQQWIADLVFAANRYKGVPGVIGIDLKN
EPHGAATWGTGNAATDWNRAAERAAAAVVQAAPRWIVAVEGVGENPSCSTSSGHFWGGNL
EPLACTPLDIPADRLLLAPHAYGPDVAMQSYFNAADFPANMPGIWEQHFGRFVQAGHAVL
PGEFGGKYGRGDPRDVQWQNALVAYLIGKGIRSGFYWSWNPNSGDTGGILDDDWNTVRTD
KVQLLNRLWGTGGANPDPDPNPNPNPNPNPNPNPNPNPNPNPNPNPNPNPNSGASFGVRQ
VTDSDWGAGYCQRVQVTNNGAAAGDWAISVGVQGTVNNLWNAVWTQSGDTLQASGVSWNR
TLAPGGTAEFGFCAAR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacttggatccgtggggagggccgtcgcactggccgccagcctgctcgcatgc
ggcaacgtggcatggagctattccatcagcaacggccaggtggtggacgacgccggccag
gccgtgcagctgcgcggcgtgaactggttcggcttcgagaccggagagcacgtggtgcac
ggcctctgggcgcgcaactggaaggacatgatcggccagatgcagcagcagggcttcaac
gccgtgcgcctgcccttctgcccgcgaagcctgcgcggcaccggccccggcagcatcgac
tacagccgcaaccccgacctgcagggactgaactcgcagcagatcctcgacaaggtcgtg
caggaaatcagcgaccgcggcatgttcgtgctgctggaccaccacacgccggattgccag
gccatcagcgagctctggtacacgccggcctacagcgagcagcagtggatcgccgacctg
gtcttcgccgccaaccgctacaagggcgtgcccggggtgatcggcatcgacctgaagaac
gagccccacggcgccgccacctggggcaccggcaacgctgccaccgactggaaccgcgcc
gccgagcgcgccgccgccgcggtcgtgcaggccgcgccgcgctggatcgtcgcggtggaa
ggcgtcggcgagaacccttcctgttccaccagcagcggccacttctggggcggcaacctg
gaacccctggcctgcacgccgctggacattcccgccgaccgcctgctgctggcgccgcac
gcctacgggcccgacgtggccatgcagtcgtatttcaacgcagcggacttccccgccaac
atgcccggcatctgggagcagcacttcggccgcttcgtgcaggccggccacgccgtgctg
ccgggcgaattcggcggcaagtacggccgcggcgacccgcgcgacgtgcagtggcagaac
gccctggtggcctacctcatcggcaagggcatccgcagcggcttctactggtcctggaat
cccaacagcggcgacaccggcggcatcctggacgacgactggaacacggtgcgcacggac
aaggtgcagctcctgaaccgcctctggggcacgggcggggccaaccccgaccccgacccc
aaccccaaccccaaccccaaccccaatcccaatcccaatcccaatcccaatcccaatccg
aatcccaatccgaatccgaatccgaatccgaattcgggtgcgagcttcggtgtgcggcag
gtcaccgacagcgactggggcgcgggctactgccagcgcgtgcaggtgaccaacaatggt
gccgccgcgggcgactgggcaatatccgtcggcgtgcagggcacggtcaacaacctctgg
aatgcggtctggacgcagtcgggcgacacgctgcaggcctccggcgtctcgtggaaccgg
acgctcgcgccagggggcaccgccgaattcggtttctgcgcggcgcgctga

DBGET integrated database retrieval system