KEGG   Acidovorax citrulli: Aave_2203Help
Entry
Aave_2203         CDS       T00451                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
aav  Acidovorax citrulli
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aave_2203
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aave_2203
   00650 Butanoate metabolism
    Aave_2203
  Energy metabolism
   00190 Oxidative phosphorylation
    Aave_2203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2423721..2424086)
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRTVVGAHYGTRDWISQRVTAALMAVFTLVVLAQLVLTKGPIGYDRWAGIFAA
QWMKVLTFSVIVGLAWHAWVGMRDVWMDYVKPVGLRLALQAVTIFWLVGCAGWGIQILWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaactatggttccaagcgcaccgtcgtcggtgcccactacggcacgcgcgac
tggatcagccagcgcgtcaccgcggccctgatggccgtcttcaccctcgtcgtgctggcg
cagctggtgctcaccaagggccccatcggctacgaccgctgggccggcatcttcgccgcg
cagtggatgaaggtcctcaccttctccgtcatcgtcggcctggcatggcatgcctgggtg
ggcatgcgcgacgtctggatggactacgtcaagcccgtcggcctgcgcctggcgctgcaa
gcggtcacgatcttctggctcgtcggctgcgccggctggggcatccagatcctctggcgc
ctctga

DBGET integrated database retrieval system