KEGG   Acidovorax citrulli: Aave_2203Help
Entry
Aave_2203         CDS       T00451                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
aav  Acidovorax citrulli
Pathway
aav00020  Citrate cycle (TCA cycle)
aav00190  Oxidative phosphorylation
aav00650  Butanoate metabolism
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
aav01200  Carbon metabolism
Module
aav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aav_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aave_2203
   00650 Butanoate metabolism
    Aave_2203
  Energy metabolism
   00190 Oxidative phosphorylation
    Aave_2203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABM32781
JGI: Aave2203
UniProt: A1TP93
Position
complement(2423721..2424086)
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRTVVGAHYGTRDWISQRVTAALMAVFTLVVLAQLVLTKGPIGYDRWAGIFAA
QWMKVLTFSVIVGLAWHAWVGMRDVWMDYVKPVGLRLALQAVTIFWLVGCAGWGIQILWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaactatggttccaagcgcaccgtcgtcggtgcccactacggcacgcgcgac
tggatcagccagcgcgtcaccgcggccctgatggccgtcttcaccctcgtcgtgctggcg
cagctggtgctcaccaagggccccatcggctacgaccgctgggccggcatcttcgccgcg
cagtggatgaaggtcctcaccttctccgtcatcgtcggcctggcatggcatgcctgggtg
ggcatgcgcgacgtctggatggactacgtcaagcccgtcggcctgcgcctggcgctgcaa
gcggtcacgatcttctggctcgtcggctgcgccggctggggcatccagatcctctggcgc
ctctga

DBGET integrated database retrieval system