KEGG   Acidovorax citrulli: Aave_2816Help
Entry
Aave_2816         CDS       T00451                                 

Definition
type 11 methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aav  Acidovorax citrulli
Brite
Enzymes [BR:aav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Aave_2816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3089275..3089985
Genome map
AA seq 236 aa AA seqDB search
MTLPLNTTADANDPVTLARYNMIEQQIRPWNVLDADVLDLLGTVRREDFVPPAYRGMAFM
DMEIPLNPSAEEAQRLGQCMLAPRVEARLLQDLQVKPTDRVLEIGAGSGYMAALLAHRAE
HVVTLEIVPDLVEFARENLLSAGIDNVAVRQGDGARDAIPDGPFDVIVLSGSVHEVPQHL
LALLREGGRLAAITGDEPVMRATFVRRTGDRFATTHPWDTNVPRLQHFAERPRFTF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccccctgaacacgaccgccgacgcgaacgaccccgtgacgctggcccgctac
aacatgatcgagcagcagatccgcccgtggaacgtgctcgatgccgatgtgctggacctg
ctgggcaccgtgcgccgcgaggatttcgtgccccccgcctaccgcggcatggcgttcatg
gacatggagatcccgctcaacccctccgccgaggaagcccagcgcctgggccagtgcatg
ctggctccgcgcgtggaagcccgcctgctgcaggacctgcaggtcaagccgaccgaccgc
gtgctggagatcggcgccggctccggctacatggcggccctgctcgcgcaccgcgccgag
cacgtggtcacgctggaaatcgtgcccgacctggtggaattcgcccgcgagaacctgctg
agcgccggcatcgacaacgtggcggtgcgccagggcgacggcgcacgagacgccatcccg
gacggcccgttcgacgtcatcgtgctgagcggctcggtacacgaagtgccgcagcacctg
ctggcgctgctgcgcgaaggcggccgcctggccgcgatcaccggcgacgagcccgtgatg
cgcgccaccttcgtgcgccgcacgggcgaccgcttcgccacgacccatccctgggacacc
aacgtcccgcgcctgcagcatttcgcggagcgcccacgcttcacgttctga

DBGET integrated database retrieval system