KEGG   Acidovorax citrulli: Aave_2924Help
Entry
Aave_2924         CDS       T00451                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aav  Acidovorax citrulli
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aav00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3212914..3214299
Genome map
AA seq 461 aa AA seqDB search
MPIPPHQASRQAPTASSAAAIPRRSVLQGGLGAAAWAATAGWSAGHAAWAATAGWSAGHA
ATASLPLAGMNLSGLGSNSFVENAQIGTHYRDISDKHIAAAGDCPLFRLPTTAQRFSTGQ
GMPLDETYTKQVGTVLDRLAAQGKRAILELHDYMRLPTRVAARQGFRIQSGQLVGPDGRA
VADPADPAVWSGTYTQGAFNYVGYFDGRDQLLKLYEYRVIGTQGCKLYTEDGLPDLWLRL
VQRFREHPAIFGWGLMNEPYTGKEKNANGSALDMRALWQRTATRTAARIFDHDRKHFVFI
CGNEFATASEWKKYSDALATIPDPYGLIVYEAHNYLDNNGQGGGAWKNPQETVAPDTGEK
MVANFLQWLQDNGKRGFLGEHGYPENNASAEVATRRMLQLLQRNNVPSTQWCFGPGWPDG
DPLGMSRDTGADTIAVKGNIAAVQPFFKERLATYLPPLRPN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcccattccaccacaccaggcatcccggcaggctccaaccgcatcgtccgcggcggcc
atcccccgccgctccgtgctccagggcggactgggtgccgccgcctgggccgccacggcc
ggctggtcggcgggacacgccgcctgggccgccacggccggctggtcggcgggacacgcc
gccaccgcatcgctgcccctggcgggcatgaacctgtcgggcctcggctcgaacagtttc
gtggagaacgcgcagatcggcacgcactaccgcgacatttccgacaagcacatcgccgcg
gcaggcgactgcccgctgtttcgcctgccgaccacggcgcagcgcttcagcacgggccag
ggcatgcccctggacgagacgtacacgaagcaggtgggcacggtgctggatcgcctggcg
gcgcagggcaagcgcgcgatcctggaactgcacgactacatgcgcctgcccacgcgggtg
gcggcgcgccagggtttccgcatccagtcgggccagctcgtggggccggatggccgcgcg
gtggccgacccggccgaccccgcggtgtggagcggtacctacacgcagggggccttcaac
tacgtgggatatttcgacggccgcgaccagttgctcaagctctacgaataccgcgtgatc
ggcacgcagggctgcaagctctacaccgaggacggcctgccggacctgtggctgcgcctc
gtgcagcggttccgcgagcatccggcgatcttcggctggggattgatgaacgagccctac
accggcaaggaaaagaacgccaatggcagcgcgctggacatgcgggcgctctggcagcgc
accgcgacgcgcacggccgcgcgcatcttcgaccacgaccgcaagcacttcgtcttcatc
tgcggcaacgaattcgcgaccgccagcgagtggaagaaatactcggacgccctggcgacc
attcccgatccgtacgggctgatcgtgtatgaggcccacaattatctggacaacaacgga
cagggcggtggtgcctggaagaatccgcaggagaccgtggcgccggacaccggcgagaag
atggtggcgaatttcctgcaatggctgcaggacaacggcaagcgcggcttcctgggcgag
cacggctatccggaaaacaatgcgagcgccgaggtggcgacgcggcgcatgctgcagctc
ctgcaaagaaacaacgtgcccagcacgcagtggtgcttcggcccgggctggccggacgga
gacccgctgggcatgagccgggacaccggcgcggacaccatcgcggtcaagggcaacatc
gcggcggtgcagcccttcttcaaggaacgcctggcgacctacctgccgccattgcgcccg
aactga

DBGET integrated database retrieval system