KEGG   Acidovorax citrulli: Aave_2924Help
Entry
Aave_2924         CDS       T00451                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aav  Acidovorax citrulli
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Aave_2924
Enzymes [BR:aav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Aave_2924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3212914..3214299
Genome map
AA seq 461 aa AA seqDB search
MPIPPHQASRQAPTASSAAAIPRRSVLQGGLGAAAWAATAGWSAGHAAWAATAGWSAGHA
ATASLPLAGMNLSGLGSNSFVENAQIGTHYRDISDKHIAAAGDCPLFRLPTTAQRFSTGQ
GMPLDETYTKQVGTVLDRLAAQGKRAILELHDYMRLPTRVAARQGFRIQSGQLVGPDGRA
VADPADPAVWSGTYTQGAFNYVGYFDGRDQLLKLYEYRVIGTQGCKLYTEDGLPDLWLRL
VQRFREHPAIFGWGLMNEPYTGKEKNANGSALDMRALWQRTATRTAARIFDHDRKHFVFI
CGNEFATASEWKKYSDALATIPDPYGLIVYEAHNYLDNNGQGGGAWKNPQETVAPDTGEK
MVANFLQWLQDNGKRGFLGEHGYPENNASAEVATRRMLQLLQRNNVPSTQWCFGPGWPDG
DPLGMSRDTGADTIAVKGNIAAVQPFFKERLATYLPPLRPN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcccattccaccacaccaggcatcccggcaggctccaaccgcatcgtccgcggcggcc
atcccccgccgctccgtgctccagggcggactgggtgccgccgcctgggccgccacggcc
ggctggtcggcgggacacgccgcctgggccgccacggccggctggtcggcgggacacgcc
gccaccgcatcgctgcccctggcgggcatgaacctgtcgggcctcggctcgaacagtttc
gtggagaacgcgcagatcggcacgcactaccgcgacatttccgacaagcacatcgccgcg
gcaggcgactgcccgctgtttcgcctgccgaccacggcgcagcgcttcagcacgggccag
ggcatgcccctggacgagacgtacacgaagcaggtgggcacggtgctggatcgcctggcg
gcgcagggcaagcgcgcgatcctggaactgcacgactacatgcgcctgcccacgcgggtg
gcggcgcgccagggtttccgcatccagtcgggccagctcgtggggccggatggccgcgcg
gtggccgacccggccgaccccgcggtgtggagcggtacctacacgcagggggccttcaac
tacgtgggatatttcgacggccgcgaccagttgctcaagctctacgaataccgcgtgatc
ggcacgcagggctgcaagctctacaccgaggacggcctgccggacctgtggctgcgcctc
gtgcagcggttccgcgagcatccggcgatcttcggctggggattgatgaacgagccctac
accggcaaggaaaagaacgccaatggcagcgcgctggacatgcgggcgctctggcagcgc
accgcgacgcgcacggccgcgcgcatcttcgaccacgaccgcaagcacttcgtcttcatc
tgcggcaacgaattcgcgaccgccagcgagtggaagaaatactcggacgccctggcgacc
attcccgatccgtacgggctgatcgtgtatgaggcccacaattatctggacaacaacgga
cagggcggtggtgcctggaagaatccgcaggagaccgtggcgccggacaccggcgagaag
atggtggcgaatttcctgcaatggctgcaggacaacggcaagcgcggcttcctgggcgag
cacggctatccggaaaacaatgcgagcgccgaggtggcgacgcggcgcatgctgcagctc
ctgcaaagaaacaacgtgcccagcacgcagtggtgcttcggcccgggctggccggacgga
gacccgctgggcatgagccgggacaccggcgcggacaccatcgcggtcaagggcaacatc
gcggcggtgcagcccttcttcaaggaacgcctggcgacctacctgccgccattgcgcccg
aactga

DBGET integrated database retrieval system