KEGG   Acidovorax citrulli: Aave_2984Help
Entry
Aave_2984         CDS       T00451                                 

Definition
(GenBank) maltooligosyl trehalose hydrolase (EC:3.2.1.141)
  KO
K01236  
maltooligosyltrehalose trehalohydrolase [EC:3.2.1.141]
Organism
aav  Acidovorax citrulli
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Aave_2984
Enzymes [BR:aav01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.141  4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase
     Aave_2984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3277378..3279201
Genome map
AA seq 607 aa AA seqDB search
MKHQHDMPIGARLLPEGGVHFTLWAPAASRLTLHHRRAPGAEPAQVPGRRDADGFWQATV
PEAGPDTLYQWQADNGPLVPDPASRSNPDGPHGPSRVTDPAAFDWTVEGWTGRPWSDTVL
YELHVGTFTPEGTFAAAMQRLPWLAEQGFTAIELMPVATFGGRHGWGYDGVLPFAPHPAY
GTPDDMKRFIDRAHALGLMVFLDVVYNHFGPDGNYLGSYAPAFFSETHHSPWGAAINFDG
KDSGPVREFFIQNALYWVREFRIDGLRLDAVHAIVDDGSPHVLEDLAQRVRQATEGRHVH
LVLENEKNESQRLAPRPEPTRYDAQWNDDFHHALHVALTGERQGYYADYAHAPLDGLAHS
FAGGYVFAPSHRDGDGRRLERAPAAPQPLATMVNFCGNHDQIGNRAFGERLSHLVPQPAA
ELALLSALLTPATPLVFMGDEFGAETPFLYFADWTGELREAVRQGRQREFRLEAGSGREL
PDPCDAATLERSRLDWRQAEGPAGQVRLALVRNALSARRQWIAPRLSRLRSGTHTARRVG
ATGLQVEWDYDDGTRLVMQMNLGKDSVTPQTPEAAAEPGLRVFQHRWEGGGAWAPWSARW
TLQGVPA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccagcacgacatgccgatcggcgcccgcctccttcctgaaggcggcgtccac
ttcaccctctgggcccccgccgcctcgcggctcaccctccaccaccgccgcgcaccgggc
gcggagcccgcgcaggttccgggccgccgggatgcggacggtttctggcaggccaccgtg
ccggaggccggcccggacacgctctatcaatggcaggcggacaatggtcccctggtgccc
gatccggcatcgcgcagcaatcccgacggtccgcacggcccgagccgcgtgaccgatccg
gccgccttcgactggacggtcgagggctggacaggccggccgtggagcgacaccgtgctc
tacgaactgcacgtgggtaccttcacgcccgagggtacgttcgccgcggccatgcagcgc
ctgccctggctggccgaacagggcttcaccgccatcgagctcatgcccgtggccaccttc
ggcgggcgccacggctggggctacgacggcgttctgccgttcgcgccgcacccggcctac
ggcacgccggacgacatgaagcgcttcatcgaccgggcccatgcgctcggcctgatggtg
ttcctggacgtcgtgtacaaccacttcggcccggacggcaactacctgggcagctacgcc
ccggccttcttctcggaaacccaccacagcccctggggcgcggccatcaatttcgacggc
aaggacagcgggccggtgcgcgagttcttcatccagaacgcgctctactgggtgcgagaa
ttccgcatcgacggcctgcgcctggatgccgtccatgccatcgtggacgacggatcgccc
cacgtgctcgaagacctcgcgcagcgcgtgcggcaggccaccgagggccggcacgtccac
ctcgtcctggaaaacgagaagaacgagagccagcgcctggccccccggcccgagcccacg
cgctacgacgcgcagtggaacgacgacttccaccatgccctgcatgtcgccctcacggga
gagcgccagggctactacgccgactacgcgcatgcgccgctggacgggctcgcgcatagc
ttcgcgggcggctatgtgttcgcgccctcgcaccgcgacggcgatggccggcgcctggaa
cgggcacccgccgcgccccagcccctggccacgatggtgaacttctgcggcaaccacgac
cagatcggcaaccgcgctttcggcgagcggctctcgcacctggtgccgcagcccgcggcc
gaactcgcactgctgtccgcgctgctcacgcccgccacgccgctggtgttcatgggcgac
gaattcggcgcggaaacacctttcctgtatttcgccgactggacgggcgagctccgcgag
gcggttcgccagggacgccagcgcgaattccggctcgaagccggctcgggccgcgaattg
cccgacccctgcgacgccgccaccctcgaacgcagccgcctcgactggcgccaggcggaa
ggccccgccggacaggtgcggctcgcgctggtccgcaacgccctgtccgcacgccggcaa
tggatcgccccgcgcctgtcccggctgcgctccggcacgcacacggcgcgccgcgtggga
gcgaccgggctgcaggtggaatgggactacgacgatggaacacgcctcgtgatgcaaatg
aacctgggcaaagactccgtcacgccgcagacccctgaggcggccgccgagcctggcctg
cgggtcttccagcaccgctgggaaggcggtggcgcctgggccccttggtccgcgcggtgg
acgctgcagggggtaccggcatga

DBGET integrated database retrieval system