KEGG   Acidovorax citrulli: Aave_2985Help
Entry
Aave_2985         CDS       T00451                                 

Definition
putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase (EC:2.4.1.25 5.4.99.15)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
aav  Acidovorax citrulli
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Aave_2985
Enzymes [BR:aav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Aave_2985
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.15  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase
     Aave_2985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3279198..3284186
Genome map
AA seq 1662 aa AA seqDB search
MNAHPHEDHDGLHERARRAGIALQYASFWGEHRDVPPEVLERVLSAMGSHADAGALPAPI
VVEEGQAAEIEWHGAASWRLVTSEVEAEKTVCEGQGPVARLPATLRAGYYRLVGSGTQQE
RFVIVAPARCWSPEPLRHGERWWGLSAQLYSLRSDRNWGIGDFSDLSELVATAAAQGAAF
VGLSPLHALRMDRPDLASPYSPSSRLALNPLFIDVTAMPEFLRSNAAQSLYADGVFQQRL
QALRAAETVQYAEVAAAKEEMLALLWDEFRQGDWESLSPRGLAFQAFVKEHAATLAPHAL
FEAIQRHLSRTSPDIWGWPAWPEELRDPQGPAAQAFAKDHAEAVAYHMWLQWTAHLQLGQ
AGERARALMPLGLYCDLAVGASDGGSETWTLQNLYARGMNVGAPPDPLNTQGQDWGLPPL
NPVALAAARFMPVRRLLHAVMHHAGALRMDHVMALMRLFWTHGGAGTYVAYPLQALLAVV
AVESHRHQCLVIGEDLGNVAPQMREAMAQRTVLSYRPLIFERMDGGAFRPPAQWPAQALA
VVSTHDLPTLRGYWSGEDIEVQKRLGWLPDSEAHARSLIERAQDRVRLLMALQEEGLLPP
GATVDAQSVPEATAEFTAAVHAYLARTPCWLAAVQIEDAIAQLEQVNVPGSTEDMQPNWR
RRLAVPLDRLATHPCFTAVASAMREHRGRPAMQAPVEELPALDTADVPLATYRVQFHKDN
TFAAMTAAVPYLHALGISHLYSSPYLKAAPGSTHGYNVVDPTQLNPEIGDEASHAALCDA
LRAHGLGQLLDIVPNHMGVIDAPNPWWDDVMEHGRSAAHADFFDIEWEPATASLQGRVLL
PMLGGQYGHVLEAGELRLDFDAETGRFLVCYWDHRLPVDPRHYARIFSAVPAPAPGEADG
DSALQVQSLIDAFGRLPDRDTGDEGERAMRLRDAPLHQRRLAELAGTHAWLRHWIAACLS
QWNGRQGEPGSFDALDGLLRDQPYRLADWRVAGDDINYRRFFDINSLAALRMEETSVFEA
AHACIFRWLAEGRITGLRIDHPDGLAHPAQYFDRLQRRYVALARAAGREPTALYLVVEKI
LADHEPLPADWPVHGATGYRFSSLVNGLFVDTASQTAFDDAYTSFTGDTKDFEEAVYECK
KHIIETSLYSDLGWLADTLYRIAQADRRTFDFTRNQLRIALTEVAAVFPVYRTYLVPDGT
PPSDTDRSHIAWAIAAARRRMGTSEGGVLAYLQGVLLGDEGAAPPLRARFIRRWQQFTAP
VMAKSVEDTVFYRYVRLVSLNDVGSEPRRFGLTCAAFHQANLQRARHRPHNLLATSTHDS
KRSEDLRARLNVLSEIPALWEDTALQLRELGERFTTEADGVQTPLPHDLWALYQALVGIW
PTHSTEPGERQELRERIQQYMVKAMREAKQQTNWLFPDEAYEGAVARYIDGALSTERFVR
ELERFVQSIAPYGFRNSLCQLALKLTVPGVPDIYQGCEHWNFSLVDPDNRRPVDFRAMAQ
ALEQVQALYDEGGHPSQADWERLMGPVPGPDAKQLVTWRLLQLRQAMPDLFRQSTYLPLT
LEGHSAEHAFAFARIRDGRAIVVICARLLYGLAAAGWRGTRISVASAHPVLAKAGGWQEW
MTGRHIGPDTGEGWSMEDILGEVLPDRPGLPFAVLVGGESGA
NT seq 4989 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccacccccacgaggaccacgacggcctgcacgaacgtgcccgccgggcaggc
atcgcgctccagtacgccagcttctggggcgagcaccgcgacgtgccgccggaggtgctc
gagcgcgtcctgtcggccatgggatcgcatgccgacgccggtgcgctgcccgcccccatc
gtcgtggaagaaggccaggcagccgagatcgaatggcatggcgccgcctcctggcggctg
gtcaccagcgaggtcgaggccgaaaaaaccgtctgcgaaggccaggggccggtcgcgcgg
ctgccggccacgctgcgcgcgggctactaccgcctcgtgggctccggcacacagcaagag
cgcttcgtcatcgtggcgcccgcgcgctgctggtcacccgagccgctgcgccacggggag
cgctggtggggcctgagcgcccagttgtactcgctgcgctcggaccgcaactggggcatc
ggcgacttctccgatctcagcgaactggtggcgaccgccgccgcccagggtgccgccttc
gtcggcctcagcccgctgcacgccctgcgcatggaccgcccggacctcgccagcccctac
agcccgtccagccgcctggcgctcaacccgctgttcatcgacgtgaccgcgatgccggag
ttcctgcgcagcaacgccgcgcagtcgctctatgccgacggcgtgttccagcagcggctg
caggccctgcgcgctgcggaaacggtgcagtatgccgaagtcgccgccgccaaggaggag
atgctcgccctgctgtgggacgagttccgccagggcgactgggaatccctgagcccgcgc
ggcctcgccttccaggctttcgtgaaggagcatgccgccacgctggcaccgcatgcgctg
ttcgaggccatacagcgccacctgtcccgcacgtcgcccgacatctggggctggcccgcc
tggcccgaggaactgcgggacccccagggtccggccgcccaggccttcgccaaggaccat
gcggaagccgtggcctaccacatgtggctgcaatggaccgcccacctgcagctcgggcag
gcgggcgagcgcgcacgcgccctcatgccgctcggcctgtactgcgacctggccgtcggc
gcgagcgacggtggctcggaaacctggacgctgcagaacctgtacgcgcgcggcatgaac
gtcggggcgccgcccgatccgctgaacacccagggccaggactggggcctgccgccgctc
aaccccgtcgcgctggccgcggcccgcttcatgccggtgcgccgcctgctgcatgccgtg
atgcatcacgccggggcgctgcgcatggaccacgtgatggcgctcatgcgccttttctgg
acccatggcggcgcaggcacctacgtcgcctatccgctgcaggcgctgctcgcggtcgtc
gccgtggaaagccaccgccaccagtgcctggtcatcggcgaagacctgggcaacgtggcg
ccgcagatgcgcgaagccatggcgcagcgcaccgtcctctcctaccgcccgctcatcttc
gaacgcatggatggcggcgccttccgcccgcccgcgcaatggccggcgcaggccctggcc
gtggtgagcacgcacgacctgcccacgctgcgcggatactggtccggcgaggacatcgag
gtacagaagcgcctgggctggctgccggattcggaagcccacgcgcgcagcctgatcgag
cgcgcgcaggaccgtgtgcggctgctgatggcgctgcaggaggaaggcctgctgcctccc
ggcgccacggtggatgcccagtccgtgcccgaagccacggcggagttcacggccgcggtg
catgcctacctcgcgcgcaccccctgctggctcgcggcggtgcagatcgaggatgccatc
gcacagctcgaacaggtcaatgtgcccggctccaccgaggacatgcaacccaactggcgc
cggcgcctcgccgtgccgctggacaggctggcgacgcacccctgcttcaccgccgtcgcc
tcggccatgcgcgagcaccgggggcgcccggccatgcaggcccccgtggaagaactgccc
gcgctcgacaccgcggacgtgccgctcgcgacctaccgcgtgcagttccacaaggacaac
accttcgcggccatgaccgccgccgtcccctacctgcacgcgctgggcatcagccatctc
tacagctcgccctacctcaaggccgcccccggcagcacgcacggctacaacgtggtcgat
cccacgcaactgaacccggagatcggcgacgaggccagccatgccgcgctgtgcgatgcc
ctgcgggcccatggcctcggccagttgctggacatcgtgcccaaccacatgggtgtgatc
gacgcccccaatccctggtgggacgacgtcatggaacacgggcggtccgccgcccacgcc
gactttttcgacatcgaatgggagcccgccaccgcgagcctgcagggccgcgtgctgctg
cccatgctcggcggccagtacggccacgtcctggaagccggcgagctgcgcctggatttc
gatgcggaaaccggtcgcttcctggtgtgctactgggaccaccggctacccgtcgatccc
cggcactacgcccgcatcttctcggccgtgcccgccccggcccccggggaggccgatggc
gacagcgccctgcaggtgcaatccctcatcgatgccttcggccgcctgcccgaccgggac
accggcgacgaaggcgagcgcgccatgcggctgcgcgatgcgcccctccaccagcggcgc
ctcgcggaactggccggcacccacgcctggctgcgccactggatcgccgcctgcctgtcc
caatggaacggccggcagggagagcccggcagcttcgacgccctggacggcctgctgcgc
gaccagccctaccgcctggcggactggcgcgtggctggcgacgacatcaattaccgccgc
ttcttcgacatcaattccctcgccgcgctgcgcatggaggaaacctccgtgttcgaggcc
gcgcatgcctgcatcttccgctggctggccgaaggccgcatcaccggcctgcgcatcgac
cacccggacggcctcgcgcacccggcgcagtatttcgaccgcctgcagcgccgctacgtc
gcgctcgcccgcgccgccggccgcgagcccacggcgctctacctcgtggtggagaagatc
ctggcggaccacgagcccctgccggccgactggcccgtgcacggcgccacaggctaccgg
ttcagcagcctggtcaacggcctcttcgtggacaccgcgtcgcagaccgccttcgacgac
gcctacaccagcttcaccggcgacacgaaggatttcgaggaagcggtgtacgagtgcaag
aagcacatcatcgaaacctcgctctacagcgacctggggtggctggccgacacgctctac
cgcatcgcgcaggcggaccggcgcaccttcgatttcacgcgcaaccagttgcgcatcgcc
ctgacggaagtggcggcggtcttccccgtctatcgcacctacctcgtgcccgacggcacg
ccgcccagcgacaccgaccggagccacatcgcctgggccatcgcggccgcgcgccgccgc
atgggcaccagcgaaggcggcgtgctggcctatctccagggcgtcctgctcggcgacgag
ggcgcggccccgcccctgcgcgcgcgattcatccgccgctggcagcagttcacggccccg
gtcatggccaagtccgtggaggacaccgtcttctaccgctacgtgcgcctcgtctcgctg
aacgacgtcggctcggagccgcgccgcttcggcctcacctgcgcggccttccaccaggcc
aacctgcagcgggcccgccaccgtccgcacaacctgctcgccacctccacgcacgacagc
aagcggtccgaagacctccgggcccgcctcaacgtgctctcggaaatccccgccctgtgg
gaagacaccgccctgcagctgcgcgagctgggcgagcgcttcaccaccgaggcggacggc
gtccaaaccccgctgccgcacgacctctgggccctgtaccaggccctggtcggcatctgg
cccacccactccaccgagccgggcgagcgccaggaactgcgcgaacgcatccagcagtac
atggtcaaggccatgcgggaggccaagcagcagaccaactggctgttcccggacgaggcc
tacgaaggcgcggtggcgcgctacatcgacggcgcgctgtcgaccgaacgcttcgtgcgc
gagctggaaaggttcgtgcagtccatcgcgccctacggcttccgcaacagcctctgccag
ctcgcactcaagctcacggtgcccggcgtgccggacatctaccagggctgcgaacactgg
aacttcagcctcgtggatccggacaatcgccgccccgtggatttccgcgccatggcacag
gccctggagcaggtgcaggcgctctacgacgagggcgggcatccgtcgcaggcggactgg
gagcgcctcatgggcccggtgcccgggccggacgccaagcaactggtcacctggcgcctg
ctgcagttgcggcaggccatgcccgacctgttccgccagtccacctacctgccgctgacg
ctggaaggccacagtgccgaacatgcattcgccttcgcccgcatccgcgacggccgggcc
atcgtggtcatctgcgcgcgcctgctctacggcctggcggcggcggggtggcgcggtacc
cggatctcggtcgcctccgcccaccccgtgctggccaaggccggcggctggcaggaatgg
atgacgggccgccacatcggcccggacaccggcgaagggtggagcatggaggacatccta
ggggaagtgcttccggaccgtcccggcctgccgttcgcggtgctcgtgggcggagaatcc
ggcgcatga

DBGET integrated database retrieval system