KEGG   Acidovorax citrulli: Aave_3020Help
Entry
Aave_3020         CDS       T00451                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
aav  Acidovorax citrulli
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Aave_3020
Enzymes [BR:aav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Aave_3020
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Aave_3020
Lipid biosynthesis proteins [BR:aav01004]
 Fatty acid synthase
  Component type
   Aave_3020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3328922..3329587
Genome map
AA seq 221 aa AA seqDB search
MRCDAFRRDFIVAAARAAFLGSCAPAALAAPAPSGAAPVVLVVGDSLSAEYGIARGTGWV
ALLEKKLAAEKIPATVVNASVSGDTTAGGRSRLPGLLAQHKPAVVVIELGGNDALRGLPL
QGTEANLKAMAEASRKAGAKVLIVGMQVPPNYGSDYTRRFENVFPSVARATDSALVPFLL
KGVADRPDAAALFQADRIHPLAEAHPAMLANVWPALRKLLR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcgatgcgatgcgttccggcgtgactttatcgtggcggccgcgagggccgcgttcctg
gggtcttgcgccccggcggcgctggccgcgcctgcgccttccggagcagcgcctgtcgtg
ctggtggtgggggattcgctgagcgccgaatacggcatcgcccgcggcacgggctgggtc
gcgctgctggaaaagaagctggccgcggagaagatccccgccaccgtcgtgaatgccagc
gtgagcggcgacaccacggcaggcggccgctcccgcctgcccggcctgctcgcccagcac
aagcccgccgtcgtggtgatcgagctggggggcaacgacgcgctgcgcggcctgccgctg
cagggcaccgaggcgaacctcaaggccatggcggaggcctcccgcaaggccggcgccaag
gtgctgatcgtgggcatgcaggtgccgcccaactatgggtcggactacacccgccggttc
gagaacgtgttcccctccgtggccagggccacggattccgcgctggtgcccttcctgctc
aagggcgtggccgaccggcccgatgccgcggcactgttccaggcggaccggatccatccg
ctggccgaggcgcacccggccatgctcgcgaacgtctggcccgcgttgcgcaagctgttg
cgctga

DBGET integrated database retrieval system