KEGG   Acidovorax citrulli: Aave_3161Help
Entry
Aave_3161         CDS       T00451                                 

Definition
DNA polymerase III chi subunit, HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
aav  Acidovorax citrulli
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aav00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aav00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:aav03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:aav03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aav03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3490437..3490871)
Genome map
AA seq 144 aa AA seqDB search
MTEIAFHFNAPDKLAYACRFARKAVRSDALLVITGPSAVLDAVDRALWALGPQDFVAHCR
QEDEADLREASPVLLATDPRAATHAQVLLNLGPTVPAGFERFGRLVEVVSSTDESDRAGA
RERWRHYAQRGYAIVRHDLVLKGG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcgccttccatttcaatgcgccggacaagctcgcctatgcgtgccgcttc
gcgcgcaaggcggtgcgcagcgatgcgctgctggtcatcacgggaccttccgccgtgctc
gatgcggtggaccgcgccctctgggcgctgggcccgcaggatttcgtcgcccactgccgc
caggaggacgaggccgatctgcgcgaggcctcgcccgtgctgctggcgaccgatccccgc
gccgccacccatgcgcaggtgctgctgaacctcggccccacggtgcccgcgggtttcgag
cgcttcggccggctggtggaagtggtgagttccaccgacgaatccgaccgcgccggagcg
cgcgagcgctggcggcactacgcccagcgcggctacgccatcgtgcgccacgacctggtg
ctgaaggggggctga

DBGET integrated database retrieval system