KEGG   Acidovorax citrulli: Aave_3231Help
Entry
Aave_3231         CDS       T00451                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aav  Acidovorax citrulli
Pathway
aav00010  Glycolysis / Gluconeogenesis
aav00071  Fatty acid degradation
aav00350  Tyrosine metabolism
aav00625  Chloroalkane and chloroalkene degradation
aav00626  Naphthalene degradation
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
aav01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_3231
  Lipid metabolism
   00071 Fatty acid degradation
    Aave_3231
  Amino acid metabolism
   00350 Tyrosine metabolism
    Aave_3231
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Aave_3231
   00626 Naphthalene degradation
    Aave_3231
Enzymes [BR:aav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Aave_3231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C TrkA_N adh_short
Motif
Other DBs
NCBI-ProteinID: ABM33793
JGI: Aave3231
UniProt: A1TS55
Position
3562017..3563051
Genome map
AA seq 344 aa AA seqDB search
MLPKTMKAAVVREFGKPLNIEEAPVPTPADDQILVKIEASGVCHTDLHAAEGDWPVKPNP
PFIPGHEGVGFVAAIGKNVKHVKEGDRVGVPWLHSACGCCTHCLGGWETLCESQSNTGYS
VNGGFADYALADPDFVGHLPKDVSFVDIAPVLCAGVTVYKGLKVTDAKPGDWVVISGIGG
LGHMAVQYAKAMGLNVAAVDVEDDKLELAKKLGASVTVNAKTADPAAYLQKEVGGAHGAL
VTAVSPKAFEQALGMVRRGGTVSLNGLPPGNFPLPIFDMVLRGITVRGSIVGTRLDLQES
LDFAARGQVRATVATEKLENINDVFARMHKGQIQGRIVLDMAAH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccaagaccatgaaagccgccgtcgtccgcgaattcggcaagccgctgaacatc
gaagaggctccggtgcctacgcccgccgacgaccagatcctcgtgaagatcgaggcctcc
ggcgtctgccacaccgacctgcacgccgccgaaggcgactggcccgtcaagccgaacccg
cctttcatccccggccacgagggcgtgggtttcgtcgcggccatcggcaagaacgtgaag
catgtgaaggaaggcgaccgcgtgggcgtgccctggctgcattcggcctgcggctgctgc
acccactgcctgggtggctgggaaaccctgtgcgaatcgcagagcaataccggctattcg
gtcaacggcggcttcgccgactacgcgctggccgacccggatttcgtgggccacctgccc
aaggacgtcagcttcgtggacatcgcccccgtgctgtgcgcgggcgtgaccgtgtacaag
ggcctgaaagtgacggatgcgaagcccggcgactgggtggtcatctccggcatcggcggc
ctgggccacatggccgtgcagtacgccaaggccatgggcctgaacgtggcggcggtggac
gtggaggacgacaagctggaactcgcgaaaaagctcggtgccagcgtgacggtcaacgcg
aagaccgccgacccggccgcctacctgcaaaaggaggtcggcggcgcccacggtgcgctg
gtcacggccgtctcgcccaaggcgttcgagcaggcgctcggcatggtgcggcgcggcggc
acggtgtcgctcaacggcctgccgcccggcaatttccccctgcccatcttcgacatggtg
ctgcgcggcatcaccgtgcgcggctccatcgtcggcacgcgcctggacctgcaggaatcg
ctggacttcgcggcacgcggccaggtcagggccaccgtggcgaccgagaagctggagaac
atcaacgacgtgttcgcgcgcatgcacaagggccagatccagggccgcatcgtgctggac
atggcggcgcactga

DBGET integrated database retrieval system