KEGG   Acidovorax citrulli: Aave_3432Help
Entry
Aave_3432         CDS       T00451                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
aav  Acidovorax citrulli
Pathway
aav01040  Biosynthesis of unsaturated fatty acids
aav01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Aave_3432
Enzymes [BR:aav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Aave_3432
Lipid biosynthesis proteins [BR:aav01004]
 Desaturase
  First
   Aave_3432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3 HTH_28
Motif
Other DBs
NCBI-ProteinID: ABM33989
JGI: Aave3432
UniProt: A1TSQ1
Position
complement(3790294..3791508)
Genome map
AA seq 404 aa AA seqDB search
MHLPDRAVFDAILAWMANGLLDLSWWEIVLYTLVTTHITIAAVTIFLHRAQAHRSVDLGA
VPSHFFRFWLWVGTGMVTKEWVAVHRKHHAKCETADDPHSPQTRGLDTVMWRGAELYRSE
AANAETLAKFGHGTPDDWVERNVYSRFAWQGVGLMLIINVLLFGAIGATVWAVQMLWIPF
WAAGVVNGIGHFWGYRNFEAQDASTNLVPWGLVIGGEELHNNHHTYPTSAKFSVKPYEFD
VGWLYISLMRRVGWATVRKVPPKLRLGAVKPVADEKTLEALIANRYEVMAGYARGVRRAC
REEIAALKARKADVSVLRTARRWLHRDAEKVPARAQEQLASARAAHPVLDTMVTMREELR
QLWLNTSQSREQLTADLQAWCRRAEESGIAALRDFSLRLRAAQA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttcccgaccgggccgttttcgatgccatccttgcctggatggccaatggcctg
ctggacctgtcctggtgggagatcgtcctctacacgctcgtgaccacccatatcacgatc
gccgccgtgacgatcttcctgcaccgcgcccaggcgcaccgctcggtggacctcggcgcc
gtcccgtcgcacttcttccgcttctggctgtgggtgggcacgggcatggtcacgaaggaa
tgggtggccgtccaccgcaagcaccacgccaagtgcgagaccgccgacgacccccacagc
ccgcagacgcgcgggctggataccgtgatgtggcgcggcgcagagctgtaccgctccgag
gccgccaatgccgagaccctggccaagttcggccacggcacgcccgacgactgggtcgag
cgcaacgtctacagccgcttcgcctggcagggcgtggggctgatgctcatcatcaacgtg
ctgctcttcggtgccatcggcgcgacggtctgggccgtgcagatgctctggatcccgttc
tgggccgcaggcgtcgtcaacggcatcggccacttctggggctatcgcaacttcgaggca
caggatgcgagcaccaatctggtgccctgggggctcgtgatcggcggcgaagaactgcac
aacaaccaccacacctatcccacctcggccaagttctcggtcaagccctatgaattcgac
gtgggctggctctacatcagcctgatgcgccgcgtgggctgggccaccgtcaggaaggtg
ccgcccaagctgcgcctgggcgccgtcaagccggtggcggacgagaagacgctcgaggcc
ttgatcgccaaccgctacgaggtcatggccggctatgcgcgcggcgtgcgccgcgcctgc
cgcgaggagatcgccgccctcaaggcccgcaaggcggacgtgtccgtgctgcgtaccgcg
cgccgctggctgcaccgcgatgccgagaaggtgcccgcgcgcgcccaggagcagctcgcc
agtgcccgcgccgcgcatcccgtgctcgacaccatggtcacgatgcgcgaggagttgcgc
cagctctggttgaacacctcgcaatcgcgcgagcagctcacggccgacctgcaggcctgg
tgccgtcgcgccgaagagagcggaatcgccgccctgcgggatttctcgctgcggctgcgg
gccgcgcaggcctga

DBGET integrated database retrieval system