KEGG   Acidovorax citrulli: Aave_3609Help
Entry
Aave_3609         CDS       T00451                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aav  Acidovorax citrulli
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Aave_3609 (ipk)
Enzymes [BR:aav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Aave_3609 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3982607..3983464
Genome map
AA seq 285 aa AA seqDB search
MRTLHDLPAPAKLNLFLHITGRRPDGYHLLQSVFMLIDWCDTLHIELRPDGGISREDMGA
GLPADDLCTRAARALQAATGTRQGAHIVLEKSIPAQAGMGGGSSDAATTLLALNRLWGLG
LGRTALERIGLSLGADIPFFLRGRNAWVEGIGETIMPLENVHALPQSRFVVVKPEAGLDT
KSIFSSPSLERNSERATISGFAAAHYQFGKNVLQPVAETLCPEVSEAIRWLEHKGLQARM
TGSGSAVFAQMTHAIDLFDLPTGWRAKVCDNLRLHPLAGWAADED
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgctccacgacctgcctgccccggccaagctcaacctgttcctgcacatcacc
gggcgcaggcccgacggctaccacctgctgcagtcggtcttcatgctgatcgactggtgc
gacacgctgcatatcgagttgcgcccggacggcggaatcagccgggaagacatgggcgcc
gggctgcctgccgacgacctctgcacgcgcgcggcccgcgcgctgcaggcggccacgggc
acgcggcagggtgcgcacatcgtcctggagaagtccatcccagcgcaggccgggatgggc
ggcggctcttcggacgcggcgaccacgctgctcgccctcaaccggctctgggggctgggc
ctgggccgcacggcgctcgagcgcatcggactgtcgctcggggccgacattcccttcttc
ttgcgcggcaggaacgcctgggtcgagggaatcggtgagacaatcatgccgctcgagaac
gtgcacgcgctgccgcagagccggttcgtggtggtcaagcccgaagccggactggatacg
aaatcgattttttcgtctccttcgctggaacgcaattcagagcgtgctacaatctcaggc
tttgctgcagcacactaccaatttggtaagaacgttctgcagccggtcgcagaaacgctc
tgccccgaggtctccgaagccatccgctggctggagcacaagggattgcaggcacgaatg
accggctcgggaagtgcggtgtttgcgcaaatgacacatgcgatcgatttattcgatctg
cccaccggatggagggcaaaagtatgtgataatctgaggctccaccccctagcagggtgg
gcagcagatgaagattga

DBGET integrated database retrieval system