KEGG   Acidovorax citrulli: Aave_3994Help
Entry
Aave_3994         CDS       T00451                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
aav  Acidovorax citrulli
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:aav00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Aave_3994
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Aave_3994
Enzymes [BR:aav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Aave_3994
Two-component system [BR:aav02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Aave_3994
Bacterial motility proteins [BR:aav02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Aave_3994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4428839..4429450)
Genome map
AA seq 203 aa AA seqDB search
MIRPTAAPQVPARPFEAIVIGGSAGSIEALSVLLPALGPAQRAAVFVVLHLPRDRRSLLC
EIFQPRCALPMREAQDKEPVQAGTVYFAPPDYHLLIDAGPSLALSVDDPVHFSRPSIDVL
FESAADAYAGRLLAILLSGANHDGAQGIAAVQAAGGTTIVQDPESAPMSSMPEAALQLCT
PAHVLSPQRIADWLAALPPGSRA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtcccaccgccgccccgcaggtgcccgcccggccgttcgaggcgatcgtcatc
ggcggttccgccggcagcatcgaggcgctgtccgtgctgctgcccgcgctcgggcccgcg
cagcgcgccgcggtgttcgtggtgctgcacctgccccgcgaccggcgcagcctgctgtgc
gagatcttccagccgcgctgcgcgctgccgatgcgcgaggcgcaggacaaggagcctgtg
caggcgggcaccgtctatttcgcgccgcccgactaccacctgctcatcgacgccgggccg
tcgctggccctgtcggtcgatgatccggtgcatttctcgcgtccgtccatcgacgttctt
ttcgagtccgccgcggacgcctacgccgggcggctgctggccatcctgctctccggcgcc
aaccacgacggggcccagggcatcgcggccgtgcaggccgcggggggcacgaccatcgtg
caagatcccgaaagcgctcccatgagttccatgcccgaagcggcgctgcagctgtgtacg
ccggcccacgtcctttcgccgcagcgcatcgccgactggctggctgcgctgccgcccggg
agccgcgcatga

DBGET integrated database retrieval system