KEGG   Acidovorax citrulli: Aave_4200Help
Entry
Aave_4200         CDS       T00451                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aav  Acidovorax citrulli
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Aave_4200
Enzymes [BR:aav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Aave_4200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4654517..4655497
Genome map
AA seq 326 aa AA seqDB search
MTVSSRSAQENHSRSAMPRIAVVGSLNMDIVLRVPRAPGAGETVMADSLHHIPGGKGGNQ
AVACARQGARVHLLGRVGNDAHGAALRAALEADAIDHAGVQTDPEAPTGIACITVESTAQ
NRIVVVGGANARFEVDARALDTALQGASNLLLQFEVPLPQVMAAARQARQRACPVVLNPS
PMQPIPDVLWPLVDTLVANEVEAALFADCDVQTPEDAAHAARLLRARGPRQVVVTLGAAG
AVACDGSGCRHHPGLRVDAVDTTAAGDTFLGALTVALARGESLDLAVQTGVRAAALCVTR
PGAQPSIPTRAEVAASPMPPEWSRIA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtctcttcccgctccgctcaggagaaccattcccgctccgctatgccgcgcatc
gccgtcgtgggcagtctcaacatggacatcgtcctgcgcgttccccgggcccccggcgcg
ggcgagaccgtgatggccgattcactgcaccatattcccgggggcaagggcggcaaccag
gcggtggcctgcgcccgccagggcgcacgggtgcatctgctgggccgcgtcgggaacgat
gcgcacggcgcggcgctgcgcgcggcactggaagcggacgccatcgaccatgccggcgtt
cagacggatcccgaagcccccaccggcatcgcctgcatcacggtggaatccaccgcgcag
aaccggatcgtcgtcgtcggcggggcgaacgcccgcttcgaggtcgatgcgcgggccctg
gacacggcgctgcagggcgcgagcaacctgctgctgcagttcgaggtgcccctgccccag
gtcatggccgccgccaggcaggcgcggcagcgtgcctgtcccgtggtgctcaatccttcg
cccatgcagccgattcccgacgtcctctggccgctggtggacaccctggtggccaacgag
gtggaagccgcgctgttcgccgactgcgacgtgcagacgcccgaagacgcggcccatgcg
gcccgcctgctgcgcgcccgcggtccccggcaggtggtggtgacgctgggcgcggcgggt
gccgtggcctgcgacggcagcggctgccgccaccatccgggcctgcgcgtggacgccgtg
gacaccacggccgcgggcgacactttcctgggcgccctgaccgtcgccctggcgcgcggc
gaatcgctcgacctggcggtgcagaccggcgtccgcgccgcggcgctgtgcgtgacccgt
ccgggcgcgcagccatcgatccccacgcgcgccgaagtggccgcatcccccatgccccct
gaatggagccgcatcgcatga

DBGET integrated database retrieval system