KEGG   Acidovorax citrulli: Aave_4327Help
Entry
Aave_4327         CDS       T00451                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
aav  Acidovorax citrulli
Brite
Enzymes [BR:aav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Aave_4327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4805678..4806598
Genome map
AA seq 306 aa AA seqDB search
MDDRSTAGHAPAAAPAAVPGTEHEYLLEGHGPLASTGVLLIHGLTGTPNEMRLLAKGLHR
AGFTVLAVQLAGHCGTQDDLVATRWQDWAASARRGAERLMQHTGRPVVACGLSMGALLAL
ALAIERPRQVAGVVALSTTFRYDGWSMPAYTRLAFLLPLFRALGIGRRSVFMEAPPYGIK
DEALRERVVSQMHSGDSVAAGLPGNPWWSVIELRALSARVRRNLGAVRAPCLVMHARNDD
IAAAGNAEDIVRGVRHAPVELVLLDDSYHMITIDRDRRTVLARTVAFAESIAQQQAQAQP
QEGATP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaggtccaccgccggccacgcgccggccgcagcccctgccgccgtgccgggc
accgagcacgaatacctcctcgaaggccacggaccgctggcctcgaccggcgtgctgctg
atccacggcctgaccggcacgcccaacgagatgcggctgctcgccaagggcctgcaccgc
gcgggcttcaccgtgctggccgtgcagctggccggccactgcgggacgcaggacgacctg
gtcgccacgcgctggcaggactgggcggccagcgcccgccgcggcgccgaacgtctcatg
cagcacaccggccggccggtcgtcgcctgcggcctgtcgatgggcgcgctgctggcgctg
gccctggccatcgagcggccgcggcaggtggccggcgtggtggccctgtccaccaccttc
cgctacgacggctggagcatgccggcctatacgcgcctggcctttctgctgccgcttttc
cgggccctcggcatcggccgccgcagcgtcttcatggaagcaccgccctacggcatcaag
gatgaagccctgcgcgagcgcgtggtgtcgcagatgcattcgggcgacagcgtggccgcc
ggcctgccgggcaacccctggtggtcggtgatcgagctgcgggcactctccgcccgcgtg
cggcgcaacctgggcgcggtgcgcgcgccctgcctggtgatgcacgcccgcaacgacgac
atcgccgcggcaggcaacgccgaggacatcgtgcgcggcgtgcgccacgccccggtggag
ctggtgctgctggacgacagctaccacatgatcaccatcgaccgcgaccgccgcacggtg
ctggcgcgcacggtggccttcgccgaatcgatcgcgcagcagcaggcgcaggcgcaaccg
caggaaggcgccacgccatga

DBGET integrated database retrieval system