KEGG   Acidovorax citrulli: Aave_4476Help
Entry
Aave_4476         CDS       T00451                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
aav  Acidovorax citrulli
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:aav00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:aav00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aav00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:aav00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:aav00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4976258..4977490
Genome map
AA seq 410 aa AA seqDB search
MDQRTRQPQPSLRAAGNPARLGALALALCAPAGAALAQQLPAPSRTAGDAWRSCTAMGSS
EARLACFDQWAGQQAWRQAPAVATGDGAGAGKPAAAPAAENAPPPPVDTTLPATRVIDVA
QVDGCRDGQYSTLSRFWELESGSDCGTFRFRGYRPISFSVVASDTVNRQPSSPAVDHTAA
SAVDYRTTETRIQLSVRTKIAQGLLTQGHPTLKDSLWVGYTQQSYWQLFSPDISRPFRAT
DHEPEVMYVYPTDARLPFGWRWRYSGVGLVHQSNGQNLPLSRSWNRVYLMTGLELDNRWT
VNARVWKRLKESAGDDDNPDIIDYMGRGEMQLGWNYDRDNTLSLTARSAFGSTGRGSVRL
EWLRAVGNDLGGIQSNLRFHTSLFSGYGDTITDYNRRRTVFSVGLSLVDF
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacgcacacgacaaccccagccttcccttcgcgccgcgggcaacccggcacgc
ctgggcgccctggcgctcgcgctctgcgctcccgcgggggccgcgctggcgcaacagctg
ccagcgccttccaggaccgcgggcgacgcatggcgcagttgcacggccatgggcagcagc
gaggcgcgcctggcctgcttcgaccagtgggccgggcagcaggcatggcggcaggcgccg
gccgtggccacgggcgacggcgcgggcgccggcaaacccgccgcagccccggcggcggag
aatgcgccgcccccgccggtggacactacgctgccggccacgcgcgtcatcgacgtggcc
caggtggatggctgccgcgacgggcagtacagcacgctctcgcgcttctgggaactggag
tcgggcagcgactgcggcaccttccgcttccgcggctaccggccgatctcgttctcggtc
gtggcctccgacaccgtgaaccgccagccctcctcgcccgcggtggaccacaccgcggcc
tcggccgtcgattaccgcaccaccgaaacccgcatccagctctcggtgcgcaccaagatc
gcgcaaggcctgctcacgcagggccacccgacgctcaaggattcgctctgggtcggctac
acgcagcagtcgtactggcagctcttcagcccggacatctcccggccgttccgcgccacc
gaccacgagccggaggtgatgtacgtctatcccaccgacgccaggctgcccttcggctgg
cgctggcgctacagcggcgtcgggctggtgcaccagtccaacgggcagaacctgccgctg
tcgcgcagctggaaccgcgtgtacctgatgaccggcctggaactggacaaccgctggacc
gtgaacgcgcgcgtctggaaacgcctgaaggaaagcgcgggcgacgacgacaacccggac
atcatcgactacatgggccggggcgagatgcagctcggctggaactacgaccgcgacaac
acgctgtcgctgacggcgcgcagcgcgttcggctccacgggcaggggctccgtgcggctg
gaatggctgcgcgcggtgggcaatgacctgggcggcatccagagcaacctgcggttccac
acgtcgctcttcagcggctacggcgacaccatcaccgactacaaccgccggcgcacggtg
ttcagcgtgggcctgagcctcgtggatttctga

DBGET integrated database retrieval system