KEGG   Acidovorax citrulli: Aave_4667Help
Entry
Aave_4667         CDS       T00451                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aav  Acidovorax citrulli
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Aave_4667
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Aave_4667
Enzymes [BR:aav01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Aave_4667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5212467..5213066
Genome map
AA seq 199 aa AA seqDB search
MPRLTAPLILALAASSAVLPAASQSTPAAPAEPAKPAPACPATLRHTMPRLQDEAPQDLC
QYRGQVLLVVNTASYCGFTGQYEGLEALHARYKTQGFAVLGFPSNDFAQETGSNAQIADF
CSNTFGVRFPMFAKSSVKGGGASPFYRELAAQAGEAPRWNFHKYLLDRKGRVVASFGSSV
APDDPKIVRAVEQQLKLFR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcctgaccgccccgctgatcctcgcactcgcggcatcctccgcagtgctgccc
gcagcctcgcaatccacgcccgccgccccggcagagcccgcgaaaccggccccggcatgc
cccgccacactgcgccacaccatgccccgcctgcaggacgaagcaccccaggatctgtgc
caatacaggggccaggtgctgctggtagtcaacaccgccagttactgcggattcaccggg
caatacgagggactggaggcgctgcacgcccgttacaagacgcaaggtttcgcagtgctg
ggctttccgtcgaacgatttcgcccaggaaaccggcagcaatgcgcaaatcgctgacttc
tgcagcaacactttcggcgtgcgctttcccatgttcgccaagagcagcgtcaagggcggc
ggcgcctcgccgttctatcgcgaactcgctgcacaagcgggagaggcgccgcgctggaac
ttccacaagtacctgctcgacaggaaaggcagggtggtggcgagcttcggcagttccgtc
gccccggacgacccaaaaatcgtccgcgcggtcgagcagcagctgaagctttttcgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system