KEGG   Candidatus Koribacter versatilis: Acid345_0083Help
Entry
Acid345_0083      CDS       T00352                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Acid345_0083
Enzymes [BR:aba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Acid345_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(84580..85074)
Genome map
AA seq 164 aa AA seqDB search
MIHTAYIALGSNLGDRQANLLDAIARIGGLGGVKRVSSWYETEPVEMTDQPWFVNAALEL
STNLEPIALLRGLLRVEQAMGRHREIPKGPRNIDLDLLLFDNEVINTPELTLPHPEMHNR
GFVLAPLAEIAPDAVHPLLRKTASTLLETLIDPAEVRRVPPSVE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgattcacacggcttacattgcgctcggttcgaacctcggagaccggcaggccaatctg
ctcgacgcgatcgctcgcatcggcggattaggcggggtgaagcgggtgtcgtcgtggtat
gaaaccgagcccgtcgagatgacggaccagccctggttcgtgaatgcggccctggaactc
agcaccaatctggaaccgatcgccctgttgcgcggcttgctccgggtggagcaagccatg
ggccgacaccgcgaaataccaaaaggcccgcggaatatcgatctcgacctgctgctattt
gataacgaagtgattaacacaccagagttgacgctgccgcatccagagatgcacaatcgc
ggcttcgtgctcgcgccgctggcagaaatcgctcccgacgccgttcatccactgctgcgc
aagaccgcatcaacactgcttgaaacgctcatcgatccagcggaagtgcgacgcgttccg
ccctccgtcgagtag

DBGET integrated database retrieval system