KEGG   Candidatus Koribacter versatilis: Acid345_0321Help
Entry
Acid345_0321      CDS       T00352                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00010  Glycolysis / Gluconeogenesis
aba00052  Galactose metabolism
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01120  Microbial metabolism in diverse environments
aba01130  Biosynthesis of antibiotics
Module
aba_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid345_0321
   00052 Galactose metabolism
    Acid345_0321
Enzymes [BR:aba01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Acid345_0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABF39326
JGI: Acid3450321
UniProt: Q1IUX4
Position
complement(347992..349119)
Genome map
AA seq 375 aa AA seqDB search
MQRIPKVLVLTLLAILTVGMAEAKTNVTKQTFGKVQDGTAVDLYTLSDGPYEARIMTYGG
VLVSFKAPDKAGKTADVILGFDDAAGFYDNFNGAHNAFFDAIIGRYANRIGKGAFTLDGK
KYDLPKNDGPNTLHGGPHGFNNVVWQGKQLPNGVELTYVSKDGEMGFPGNMTATVKYTLT
KGDLRIEYSATTDKATVVNLTNHSYFNLAGEGSGDILKHQLMINASKITPVDATLIPTGE
LTSVDGTPFDFRKSTEIGARINNDDEQLKRGHGYDHNWVLDSTGGKLAEAAEVYEPTSGR
VLKVLTDQPGIQFYSGNFLDGAVKGKGGKPYTHRSGLCLETQHFPDTPNHANFPSAELKP
GQKYHTVTVFSFSTR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaatcccaaaagttctcgtgctgacgctccttgctattcttaccgtcggcatg
gcggaagcgaaaaccaacgtgactaagcaaacattcggcaaagttcaggacggcactgcc
gtcgacctctacaccttgagcgacggcccgtacgaagcccgcatcatgacctacggcggc
gtgcttgtttccttcaaagcgcccgataaagccggcaagactgccgacgtgatcctcggc
ttcgacgatgctgccggtttctatgacaacttcaacggcgcgcacaatgcatttttcgac
gccatcatcggtcgctacgccaatcgcattggcaaaggtgcattcactctcgacgggaag
aaatacgacctgccgaagaacgatggtccgaacacgctgcatggtggcccgcacggtttt
aacaacgtggtgtggcaaggcaagcaactcccgaacggcgtggaactcacctacgtgagc
aaagacggcgagatgggcttccccgggaacatgaccgccaccgtgaagtacacgctcacc
aagggcgatttgcggatcgagtactcggcgacgaccgacaaggccactgtcgtgaacctg
accaatcactcctacttcaacctggcgggcgaagggtcaggcgacattctgaaacatcag
ctcatgatcaacgcctcgaaaatcacgcccgtggacgcgactttgattccgactggcgag
ctgacttcagtcgacggcacgcccttcgacttccgcaaatccaccgagatcggcgcacgc
atcaacaacgacgatgagcaactcaagcgcggccacggctacgatcacaactgggtgctc
gactcaacaggcggtaagcttgccgaggctgcagaagtgtacgagccaacttccggccgc
gtgctgaaagtactcaccgatcagcccggcatccagttctactccggcaacttcctcgat
ggcgccgtaaaaggcaaaggcggcaagccctacacccatcgctcgggattgtgcctggag
acgcagcatttccccgacacacccaaccacgcgaacttcccgtccgccgaactgaagccg
ggacagaagtaccacaccgtcacggtcttcagtttctcgactcgctag

DBGET integrated database retrieval system