KEGG   Candidatus Koribacter versatilis: Acid345_0361Help
Entry
Acid345_0361      CDS       T00352                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
aba  Candidatus Koribacter versatilis
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Acid345_0361
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Acid345_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(400022..401692)
Genome map
AA seq 556 aa AA seqDB search
MQDDQRQFDFDFIVIGSGFGGSVSALRLTEKGYKVAVMEMGRRWTPDNLPKTNWSLARWF
WRPGLGLRGFFSMRFFSRVTILHGCAVGGGSITYASTLLRAPDKVWDSGTWKGLSNWKSE
MPRHYETASRMLGVTQNKILGPADHLLKQVAVASGAGETFYRTNVGIFQAPEGEAGGLTY
ADPYFGGEGPARTTCNACGGCMIGCRHGAKNTLDLNYLYLAEKRGMKIFAETRVVDVQPL
GAVDGREGYEVTTERSTSFVFKNRQRFTCRGIVFSASSLGTTELLFRLKTKHSLPNISDQ
LGNRVRTNSESLIGVRVPKSEQDLSRGVAIGSGVYIDDHTHIEAVRYPKGSDVMGGLATT
LTAGKPGIGRIALWFKNLLVSFCTHPVRTVRLLQPFGFARESVILLCMQALEGHIDMRWK
RPWYWPVRRVLVSSGQRIPTFIPAANQFAQVFAKMAGGTAMSMLPEILFNIPATAHCLGG
AVIGASPVDGVIDARHRVFGYTNMYVCDGSVVAANLGVNPSLTITALAERAMEFIPLASA
HTWTDRADSIEVSKAV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgaccagcggcagtttgatttcgacttcatcgtcatcggctcaggatttggc
ggaagtgtctccgcgctgcgactcacggaaaagggctacaaggtcgcagtgatggagatg
gggcgtcgctggacgcccgacaaccttccgaagaccaattggtcgctcgcgcgctggttc
tggcgaccggggctcgggctgcgcggcttcttcagcatgaggtttttcagtcgcgtcaca
atcttgcatggatgcgcggtgggcggcggctccatcacctatgccagcacgctgctgcgt
gcgccggataaagtatgggacagcggcacctggaagggactgtcgaattggaagtcggag
atgccgcgccactacgagacggcgtcgcgcatgctcggtgttactcagaacaagatcctc
gggcccgccgatcatctgctgaagcaagttgccgtcgcctccggagcaggcgagacgttt
taccgcaccaacgtcggcattttccaggcgcccgaaggcgaagctggtggactgacctat
gccgatccgtacttcggtggcgaaggtccagcgcgcaccacctgcaacgcctgtggtggc
tgcatgatcggttgccgtcacggcgcgaagaacacgctcgatcttaactatctctacctc
gctgagaagcgcggtatgaagatcttcgcggagacgcgtgtggtggacgttcagccgctt
ggcgcggtggatggcagagaagggtacgaagtcactactgaacgctcgacctcattcgtg
ttcaagaaccggcaacgcttcacgtgtcggggtattgtgttctcggcatcgtcactcggt
acgacggagcttctcttccgcctgaagacgaagcattcgctgccaaacatcagcgatcag
ctcggcaatcgtgtgcgtacgaatagcgaatcactcatcggagtgcgggtgccgaaatcc
gagcaagatctttctcgcggggttgcgatcggttcgggcgtttacatcgacgaccacacg
cacattgaagccgtgcgttatcccaaaggttccgatgtcatgggcggccttgcaaccact
cttactgcgggcaagcctggcattggacgcattgcgctctggttcaagaacttgctggtc
tcattctgcacgcatccggtgcgcaccgttcgactgcttcagcccttcggtttcgcgcgc
gaatccgtcatcctgctctgcatgcaggcgctggagggacacattgatatgcggtggaaa
cgtccctggtattggcctgttcgccgcgtgctcgtcagcagcggacagcgcatcccaacc
ttcattcctgcggccaatcagttcgcgcaggtattcgccaagatggcgggtggcaccgcg
atgagtatgttgccggagattctcttcaatattcccgcgaccgcccattgcctcggtggc
gctgtaatcggcgcatcgccggtggacggcgtgattgacgcgcggcaccgcgtctttggc
tacaccaatatgtatgtttgcgatggctctgtcgttgccgcaaacctcggcgtcaatccc
agcctgacgattacggcgttggcggagcgcgcgatggagttcattccactcgcgagcgcg
catacgtggaccgatcgcgctgattccatcgaagtctctaaagctgtctag

DBGET integrated database retrieval system