KEGG   Candidatus Koribacter versatilis: Acid345_0379Help
Entry
Acid345_0379      CDS       T00352                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Acid345_0379
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid345_0379
   00620 Pyruvate metabolism
    Acid345_0379
   00650 Butanoate metabolism
    Acid345_0379
  Lipid metabolism
   00071 Fatty acid degradation
    Acid345_0379
  Amino acid metabolism
   00350 Tyrosine metabolism
    Acid345_0379
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Acid345_0379
   00626 Naphthalene degradation
    Acid345_0379
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Acid345_0379
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Acid345_0379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
428324..430969
Genome map
AA seq 881 aa AA seqDB search
MPTKTLEEKTAKLSPERIAHLEGLVDNARAAASAFLQFTQEDVDRIVKQMVLAGMEHAQK
LAQMAVEETMLGVLEDKVIKNMVATEFVYNYVKDKRTVGIIREYPERRLTEIAEPIGVIF
SLIPITNPTSTVLFKCIMAIKTRNAVIFSPHPRAWRCCKEAVHVMYEAARKHGAPDGVFA
CLESHNLDDNDYLMHHKYVSMIDATGGPSAVKAAYSSGKPALGVGAGNTPVYLEKTADIN
MAVVDIITSKTFDNGTICASEQTVVIDDEIYDTVLKKFSDLGTHICNEGETELLGRTVID
PDTGAMQPMAVGQKAADIAAAVGIEVQPKTKLIIAPIKGVGPNHPLSVEKLFPVLAVYRA
HSTEEALDVCVAVNRAGGLGHTAVIFSRNDDIIHRFGILLNAGRLIVNSPGSIGALGGVY
NDMVPTFSFGCGTGGGNSTMDNVNVYHYLNIKRLARRTPPSMWFRIPNQIYFNPNSIQNL
ATFPTRSTVIVTNPPLEQMGHVDIVRRYIPADTRIHVLVIPDCEPELKAVMDGVEALNFY
KADQIIALGGGSVIDAAKMMKLKYESPDANFEELGSPFLDLRKRVVQFPTEKKHHARLIA
VPTTSGTGSEVTPFAVLFDKARQRKITLADYSLSPDVAIVDPQFVMSMPKGLTADTGIDC
LTHALEAGVSNYASPYTDSNAMQAIRLAFKYLPIAYENPQDEEARNTMHNAATIAAIAFS
NASVGLNHALAHAFGARFGVPHGRANALMLPHVIAFNAAVPQKFMPSPNQQGYVAHKKYA
MIADLLGLPGHTVEEKVASLITAVEELLDRLNLPRSIASMGIKREDFESAMPELVKAAFE
DPSWLSNPRMPLMSELQELFLQAYEGSGRKKAEAREEATVS
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccaaaacacttgaagaaaagactgcaaaacttagcccagagcgaatcgcccac
ctcgagggcctcgtcgacaacgcccgcgccgccgcatccgcgttcctgcaattcacccag
gaggacgtagaccgcatcgtgaagcaaatggtcctcgccggcatggaacacgcgcagaaa
ctcgcgcagatggccgtcgaagagaccatgctcggcgtcctcgaagacaaggtcatcaag
aacatggtggctaccgagttcgtctacaactatgtcaaggacaagcgcaccgtcggcatt
attcgcgaatatcccgagcgccggctgaccgagatcgccgaacccattggcgtgatcttt
tcgctcatccccatcacgaacccaacttcgaccgttcttttcaagtgcatcatggcgatc
aaaacgcgcaacgcggtcatcttcagcccgcatccgcgcgcctggcgctgctgcaaggaa
gccgtccatgtgatgtatgaggctgcgcgcaagcacggcgctcccgacggtgtcttcgcc
tgcctcgaatcccacaacctcgacgacaacgactacctgatgcaccacaaatatgtctcg
atgatcgacgccaccggtggcccgagcgccgtgaaagccgcgtatagctccggtaaaccg
gctctcggcgtcggcgccggcaacacgcccgtctatctcgagaagaccgctgacatcaac
atggctgtcgttgacatcatcacctccaagacattcgacaacggcaccatctgcgcctct
gaacaaactgtcgtcattgacgacgagatctacgacactgtattgaagaagttctccgac
ctcggcacgcacatctgcaacgaaggcgagaccgaactgctcggtcgtactgtcattgat
cctgacaccggcgccatgcaacccatggcggtcggtcagaaagccgctgatatcgccgct
gctgtcggcatcgaagtgcagcccaagacgaagctgatcatcgcgccaatcaagggtgtc
ggcccgaatcacccgctctccgttgaaaagctcttcccggtgctcgccgtctatcgcgcc
cactcaaccgaagaagcgctcgacgtctgcgtcgccgtgaatcgcgccggaggtctcggc
cacaccgccgtcatcttctccaggaacgacgacatcattcaccgcttcggcattctgctc
aacgccggccgcctcatcgtcaactcgcccggctccatcggcgccctcggcggagtttat
aacgacatggtcccgacgttttccttcggctgcggcaccggcggcggcaacagcaccatg
gacaacgtcaacgtctatcactacctcaacatcaagcggctcgcgcggaggacgcctcct
tctatgtggttccgcatccccaaccagatttacttcaacccgaattccatccagaacctg
gctacgttccccacccgctccacggtcatcgtcaccaacccaccgctcgagcagatggga
cacgtggatatcgtgcgccgatacatccccgccgacacgcgcattcacgtcctcgtcatc
cccgattgcgaaccggaactgaaggcggtcatggatggtgtcgaagcgctgaacttctac
aaagccgatcagatcatcgccctcggaggcggctccgtgatcgacgccgcgaagatgatg
aagttgaaatatgaatcgccggatgcgaacttcgaagaactcggctcgccgttcctcgat
cttcgcaagcgggtcgtccaattcccgaccgagaagaagcaccacgcgcgtttgatcgcc
gttcccaccaccagcggcaccggcagcgaagtcacccccttcgccgttctcttcgataaa
gcccgccagcgcaagatcaccctcgccgactactcgctcagccccgacgtcgccatcgtc
gatccgcagttcgtcatgtcgatgcccaaaggcctcaccgccgataccggcatcgactgc
ctgacccacgcgctcgaagccggcgtctcaaactacgccagcccctataccgactccaac
gccatgcaggccatccgcctcgcgttcaagtacctgccgatcgcctacgaaaatccgcag
gacgaagaagcccgcaacaccatgcacaacgcggccaccatcgccgcaatcgcgttctcc
aatgcgtcggtcggactcaatcacgcactagcccacgccttcggcgcacgcttcggcgtc
ccccacggccgcgccaacgccttaatgctgccgcacgtaatcgccttcaacgccgccgtt
ccgcagaagttcatgccgtcgccgaaccagcagggctacgtggcgcacaagaagtacgcc
atgatcgccgaccttctcggattgcccggtcacaccgtcgaagagaaagtcgcaagcctc
atcaccgccgtcgaggagttgctcgatcgcctcaacctcccacgctccatcgccagcatg
ggcatcaaacgcgaagacttcgaaagtgccatgcccgagctggtcaaagccgctttcgaa
gacccgtcctggctctccaacccgcgcatgccgctgatgtccgagcttcaggaactcttc
ctgcaagcctacgaaggttccggcaggaagaaagcagaggcgagagaagaagcaactgtc
tcgtag

DBGET integrated database retrieval system