KEGG   Candidatus Koribacter versatilis: Acid345_0695Help
Entry
Acid345_0695      CDS       T00352                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Acid345_0695
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Acid345_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
856658..858133
Genome map
AA seq 491 aa AA seqDB search
MRIAIIGGGISGLSAAYTLEKERAKGADVEYTLFESSNRLGGACYSEIVDGCVIEAGPDS
FVSEKPWAAALCRELGIGDQLIGSNDNDRKTWIVNKGKLISLPDGLMFLVPTKILPTAFS
PLFSWSTKLRMARELMHPPRPMNGDETVAAFVERHFGREMVDRLADPMLSGIYGGDTDQL
SVRATLARFVEMEAKYGSLSRAMLVANKKMKAAMAGKPKPPLFTSLRNGMQQMVDAVLAK
LPSECLTLNTAVESIEKRDGKYYLTLSSAQGFVSGQRFSAAETAPMENGALAPANAEIFD
AIILATPANIAGRLLANIDNHLSEDLAAIPYSSSATVILAYDMADLKSLPGGHGFLVPRT
EGRRMRACTFVHNKFPHRAPPDKGVLRCFMGGANDAAILQSSDEEITAIVQRELREIVHL
EAQPKLVRVYRWRGAMAQYPLSHLDRVDRIEKAIAAIPGLAVAGNAFRGIGVPDCVRTGT
VAAQSVLDHRK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgcgatcatcggcggcggaatctccggcctcagcgccgcttacacactcgaa
aaagaacgcgcaaaaggcgctgacgtcgagtacacgctcttcgagagcagcaaccgcctc
ggcggcgcctgctactccgagatcgtggatggctgcgtgatcgaagccggaccggactcg
ttcgtctccgagaagccgtgggccgccgcgctctgtcgcgaactcggcatcggcgaccag
ctcatcggttccaacgacaatgaccgcaaaacctggatcgtcaacaaggggaagctcatc
tcgcttcccgacggcctcatgttcctcgtccccacgaaaattctgcccaccgcgttcagc
ccgctcttctcgtggagcaccaagcttcgcatggcgcgcgagctcatgcacccgccgcgt
cccatgaacggtgacgaaaccgtggccgcgtttgtcgaacgccacttcggccgcgaaatg
gtcgaccgcctcgccgaccccatgctctccggcatctacggcggcgataccgaccagctc
agcgtccgcgccactctcgcgcgcttcgtcgaaatggaagcgaagtacggcagcctaagc
cgcgccatgctcgtcgccaataaaaaaatgaaagcggcgatggcaggcaagcccaagccg
ccccttttcacctctctccgtaacggcatgcagcaaatggttgacgccgtactcgcgaaa
cttccgtccgagtgcctcacgctaaacacggccgtcgaatccattgaaaaacgcgacggc
aagtactacttgacgctcagctccgctcaaggctttgtatcagggcagcgcttcagcgct
gccgaaaccgctcctatggaaaatggggctttagcccctgctaatgccgaaatcttcgac
gcgatcatcctcgccacgcccgccaacatcgccggccgcttacttgcaaatatcgataac
catctatccgaggatctcgccgccatcccctacagctcctccgccaccgtcatcctcgcc
tacgacatggccgacctcaaatcccttcccggcggacacggcttcctcgtcccgcgcacc
gaaggccgccgtatgcgcgcctgcaccttcgtccacaacaagttcccgcaccgcgccccg
cccgacaaaggcgtcctgcgctgcttcatgggcggcgccaacgacgctgccatcctgcaa
tcaagcgacgaagagatcacggccatcgtccagcgcgagctacgcgaaatcgtccaccta
gaagcgcagcccaagctcgtccgcgtctaccgctggcgcggcgccatggcgcaatatccc
ctcagccacctcgaccgtgtcgatcgcatcgagaaagccattgctgccatccccggcctc
gccgtagccggcaacgcattccgcggcatcggcgtgccggactgcgtgcgaacaggaacc
gtcgcggcgcaatccgtactcgaccatcgcaaatag

DBGET integrated database retrieval system