KEGG   Candidatus Koribacter versatilis: Acid345_0695Help
Entry
Acid345_0695      CDS       T00352                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aba00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
856658..858133
Genome map
AA seq 491 aa AA seqDB search
MRIAIIGGGISGLSAAYTLEKERAKGADVEYTLFESSNRLGGACYSEIVDGCVIEAGPDS
FVSEKPWAAALCRELGIGDQLIGSNDNDRKTWIVNKGKLISLPDGLMFLVPTKILPTAFS
PLFSWSTKLRMARELMHPPRPMNGDETVAAFVERHFGREMVDRLADPMLSGIYGGDTDQL
SVRATLARFVEMEAKYGSLSRAMLVANKKMKAAMAGKPKPPLFTSLRNGMQQMVDAVLAK
LPSECLTLNTAVESIEKRDGKYYLTLSSAQGFVSGQRFSAAETAPMENGALAPANAEIFD
AIILATPANIAGRLLANIDNHLSEDLAAIPYSSSATVILAYDMADLKSLPGGHGFLVPRT
EGRRMRACTFVHNKFPHRAPPDKGVLRCFMGGANDAAILQSSDEEITAIVQRELREIVHL
EAQPKLVRVYRWRGAMAQYPLSHLDRVDRIEKAIAAIPGLAVAGNAFRGIGVPDCVRTGT
VAAQSVLDHRK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgcgatcatcggcggcggaatctccggcctcagcgccgcttacacactcgaa
aaagaacgcgcaaaaggcgctgacgtcgagtacacgctcttcgagagcagcaaccgcctc
ggcggcgcctgctactccgagatcgtggatggctgcgtgatcgaagccggaccggactcg
ttcgtctccgagaagccgtgggccgccgcgctctgtcgcgaactcggcatcggcgaccag
ctcatcggttccaacgacaatgaccgcaaaacctggatcgtcaacaaggggaagctcatc
tcgcttcccgacggcctcatgttcctcgtccccacgaaaattctgcccaccgcgttcagc
ccgctcttctcgtggagcaccaagcttcgcatggcgcgcgagctcatgcacccgccgcgt
cccatgaacggtgacgaaaccgtggccgcgtttgtcgaacgccacttcggccgcgaaatg
gtcgaccgcctcgccgaccccatgctctccggcatctacggcggcgataccgaccagctc
agcgtccgcgccactctcgcgcgcttcgtcgaaatggaagcgaagtacggcagcctaagc
cgcgccatgctcgtcgccaataaaaaaatgaaagcggcgatggcaggcaagcccaagccg
ccccttttcacctctctccgtaacggcatgcagcaaatggttgacgccgtactcgcgaaa
cttccgtccgagtgcctcacgctaaacacggccgtcgaatccattgaaaaacgcgacggc
aagtactacttgacgctcagctccgctcaaggctttgtatcagggcagcgcttcagcgct
gccgaaaccgctcctatggaaaatggggctttagcccctgctaatgccgaaatcttcgac
gcgatcatcctcgccacgcccgccaacatcgccggccgcttacttgcaaatatcgataac
catctatccgaggatctcgccgccatcccctacagctcctccgccaccgtcatcctcgcc
tacgacatggccgacctcaaatcccttcccggcggacacggcttcctcgtcccgcgcacc
gaaggccgccgtatgcgcgcctgcaccttcgtccacaacaagttcccgcaccgcgccccg
cccgacaaaggcgtcctgcgctgcttcatgggcggcgccaacgacgctgccatcctgcaa
tcaagcgacgaagagatcacggccatcgtccagcgcgagctacgcgaaatcgtccaccta
gaagcgcagcccaagctcgtccgcgtctaccgctggcgcggcgccatggcgcaatatccc
ctcagccacctcgaccgtgtcgatcgcatcgagaaagccattgctgccatccccggcctc
gccgtagccggcaacgcattccgcggcatcggcgtgccggactgcgtgcgaacaggaacc
gtcgcggcgcaatccgtactcgaccatcgcaaatag

DBGET integrated database retrieval system