KEGG   Candidatus Koribacter versatilis: Acid345_0901Help
Entry
Acid345_0901      CDS       T00352                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aba00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1127585..1129642
Genome map
AA seq 685 aa AA seqDB search
MNALKRLLVFSAVAGLLTVFAPAQKTNAPSNSGLMLGVAWYPEQWPEDRWEKDLVLMQAA
GIHVVRIGEFAWSTMEPSEGKYELDWLQRATRLAAKHHIDVILGTPTAAPPVWLTQKYPD
TLLIDEQGKRAVHGNRAHFSFTSPRYREFCRKIAEEMARKLAKEPNVIGWQLDNEVSNPS
YDGYTRAQFQEWLKDKYKGLDALNQHWTTAYWSQTYFDWSQIPIPVGGNNPGLMLDWKRF
ITDTWYSYLSNQIAAIRKYAPASQPICTNTMGLFDGFDHYKVESELDIVAWDHYVGQGHL
NPDFAGFIHDLNRGLKQKNFWVIETQPGAVNWQSINNVLDKGEVRAMAWHDVAHGADMVS
YWQWRSALNGQEEYHGVLVGADGTPVPVYDEVKQVGNDFAKAYPVLAGTSPHSEVAMLHD
YDSRWAIDWQKHNRNYDQIKIHVSYYHALRKLVHSIDVVNPSVALKNYKVVVAPNLSLIP
DSLAKHLREYVEQGGHLVLGPRAGMKDEFNALLTERQPGALVDTLGGRVEQFYALDQDVP
LEGPLGSGHSSLWAEQLSAKPGTDALLTFGKSNGWLDRQPAIISRKVGKGRITYVGAVLD
ESLMDKFAGWIFSTSGLHSAFGLIPDGVDVSERSGNGKDVFVLINFKQENQSVQLPKSMK
RVLANGESVSSVNLPPYGVEVLEAQ
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcattaaaacggctattggtcttcagcgcagttgctggattgctcaccgtgttc
gctccagctcagaagacgaacgcgccatcgaattcaggattgatgctgggagttgcatgg
tatccagagcaatggcccgaagaccgctgggagaaagatctcgtcctcatgcaagcggcg
ggaatccacgtagtgcgtatcggagagttcgcgtggagcacgatggaaccgagcgaggga
aaatacgaactcgattggctccagcgcgcgacccgactcgctgcgaagcatcacatcgac
gtcattcttggcactcctactgcggcccctccagtctggttaactcagaaataccccgat
actttgctcatcgacgaacagggaaaacgcgcggtgcatggcaatcgcgcccacttttca
ttcacgagcccacgctaccgcgagttctgccgcaagattgcggaagagatggcgcggaaa
ctggcgaaagagccgaacgttatcggctggcaactggacaatgaggtttccaatccgtcg
tatgacgggtacacacgcgcgcagttccaggaatggctgaaggacaaatataagggtctc
gacgctctcaatcagcactggacgacagcctactggagtcaaacgtacttcgattggtcg
cagattccgatcccagtgggcggcaataaccccggcctcatgctcgattggaaacggttc
atcaccgacacttggtatagctatctttcgaatcagatcgcggcaattcgcaagtacgcg
ccggcgtcccaaccgatttgtacaaacacaatgggactcttcgatggtttcgaccactac
aaagttgaaagtgaactcgacatcgtcgcgtgggaccattacgtcggccagggccacctt
aatccggactttgccggattcatccacgacctgaatcgcggattgaagcagaagaacttc
tgggtgatcgagacacaaccgggcgcggtgaattggcaatcgatcaataacgtgttggac
aaaggtgaagtgcgagcgatggcttggcacgacgttgcgcacggcgcggacatggtgagt
tattggcaatggagaagcgcactgaatgggcaggaggaatatcacggagtgctggtgggc
gcggacggcacccctgttccggtttacgacgaagtgaaacaggttggtaacgacttcgcg
aaggcgtatccagttctcgcgggaacgtcgccgcattccgaagttgcgatgctgcatgac
tacgacagccgttgggcgatcgattggcagaagcacaatcgcaactacgatcagatcaaa
atccatgtctcgtactaccacgccctccgaaaactggtccacagcatagatgtcgtgaat
ccttcagttgcactcaaaaactacaaagtcgtcgttgctccaaatctgagtctcattccc
gactcgctggcaaagcatttgcgtgaatacgtggaacaaggggggcatctcgtcctcggg
ccgagagccggcatgaaagacgagttcaacgcgttgcttacggaacgacagcctggagca
ctggtcgatactctcggcgggcgagtggagcaattctatgctttggatcaggacgttcct
ctcgaaggccctcttgggtcggggcactcttccctctgggccgaacaacttagcgcaaag
ccgggaacggatgccttgctcacctttggaaaaagcaacggttggctcgaccgtcagcct
gcaatcatctcgcgcaaagtcgggaagggaagaatcacatacgtgggggccgtgctcgat
gaatccctgatggacaaatttgccggatggatattctcgaccagtggattgcattctgca
tttggtctcattccggatggtgttgatgtttcggagcgaagtggcaatgggaaagacgtg
ttcgtgctcattaacttcaagcaagagaaccaaagcgtgcaactcccgaagagcatgaag
cgggtactcgcgaatggggaatcggtgagtagcgtaaatctgccgccgtacggagtggag
gtcctggaggcgcaatga

DBGET integrated database retrieval system