KEGG   Candidatus Koribacter versatilis: Acid345_0903Help
Entry
Acid345_0903      CDS       T00352                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:aba00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aba00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1131222..1132379)
Genome map
AA seq 385 aa AA seqDB search
MSDAYQPRPEHKFSFGLWTIANRGRDPFGDAVRPTIPPNDIVALLREVGAWGVNLHDNDL
VPIDATPSERDKIVRDFQAACRQHGIVVPMATVNLFFDPIFKDGAFTANDADVRAYALQK
TMRAMDLGAELGAKLFVLWGGREGTETDACRRPEEPFKRLREAIDYLCEYNLDKKYGFKF
ALEAKPNEPRGDIYMPTTGAYLGFIPTLAHPEMVGVNPEVAHEHMAGLNALHAVAQAWEA
GKLFHIDLNDQNPGRYDQDFRFASATPKSMFWLVKFLEDSGYQGPRHFDAHAYRTEDIAG
VKDFARGCMRSYLILKEKAQRWNADKEIQQIFSEINPQTTGSSKYSHDGALSLLNRTYDR
AAIAKRGLQYERLDQLTMELLWGIR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgcttaccagccgcgaccggaacacaagttctcgttcggcctttggacgatc
gcgaaccgcggccgcgatcctttcggcgatgcagtgcgccccactatccctccgaacgac
attgtcgctttgctccgcgaggtaggcgcatggggggtcaatcttcacgataacgatctt
gttccaattgacgcgacgccatccgagcgcgacaagatcgtccgcgattttcaggcggcc
tgcaggcagcacggcatcgtcgtgccgatggcgacggtcaacttgttcttcgatccaatc
ttcaaagatggagctttcaccgcaaacgacgccgatgtgcgtgcgtacgctcttcagaag
acgatgcgcgctatggatctcggcgccgagttaggcgctaagctctttgtgctctggggt
gggcgcgaaggaactgagactgatgcgtgccgccgtcccgaagaacccttcaagcggttg
cgcgaagccatcgattatttgtgcgaatacaatctcgacaaaaagtatggtttcaaattt
gcgttggaggccaagccaaacgaacctcgcggcgacatatacatgccgacgactggtgcc
tatctcggtttcatcccaacccttgcgcatccggagatggttggtgtaaatcctgaggtc
gcgcacgagcacatggcgggattgaacgcgcttcacgcggttgcgcaagcatgggaagcg
ggcaaactcttccacatcgatctaaacgatcagaaccctgggcgctatgaccaggatttt
cgttttgcatctgcaaccccaaaatcaatgttctggttggtgaagttccttgaagactcg
gggtatcaagggccgcgccactttgacgcgcacgcttacaggacagaagacatcgccggc
gtaaaggattttgcgcgcggatgcatgcgaagctacctgatcctgaaggaaaaggcgcag
cgctggaatgccgacaaggagatccagcaaatcttctccgagatcaacccgcaaaccacc
ggcagctcgaaatattcacacgatggcgctctgtctcttctcaaccgcacctatgatcgc
gcagccattgcgaagcgcggcctgcaatacgagcgcctcgatcagctgactatggaactg
ttgtggggaatacggtaa

DBGET integrated database retrieval system