KEGG   Candidatus Koribacter versatilis: Acid345_1156Help
Entry
Acid345_1156      CDS       T00352                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aba01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:aba00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1442302..1443084
Genome map
AA seq 260 aa AA seqDB search
MSSTLQAILDDTRRDLAARKSAARTKEFEKRAAEHTPRGFRTALWERAQAGVAVIAELKK
ASPSKGLIRANFDVIALAKELEEAGAAALSVLTDVPHFQGSLENLERASQTVRIPCLRKD
FILDPAQIVEARAYGADAILLIVAALTDLDLRNLRDEAKRYGLDVLCEVHDRDELKRAAD
LGFDLIGVNNRNLKTFRVDIENSLRFAEEFPPNALRVAESGIHSREDIDRLRDAAYSAFL
IGESLMRADSPSATLRELIG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgaccctacaggcgatcctggacgacacccggcgtgatctcgcggcccggaag
tcggctgcgcggaccaaagagttcgaaaagcgagccgcggagcatacaccgcgcggattt
cgcacggcactgtgggagcgtgcccaggccggcgtcgccgtgatcgcggagttgaagaag
gcgtcgccgtcgaaggggctgattcgggcgaacttcgacgtgatagctctagcaaaagag
ctagaagaagcgggtgctgcggcgctttcagtgcttaccgacgttccgcacttccaagga
tcgctggagaatctggaacgcgcgtcgcagacggtgaggattccatgcctgcgcaaggac
ttcatcctggatccggcgcagatcgtagaggctcgcgcctatggggcggatgcgatcctg
ctgattgtcgcggcgctcaccgacttggatttgcgcaatcttcgcgacgaggccaagcgt
tacggtctcgatgttctttgcgaagtccacgatcgcgatgagctgaaacgtgccgctgac
ctgggtttcgacctaattggcgtgaataaccggaacctgaagacatttcgcgtggatatc
gagaactcactgcgctttgccgaggagtttccgccgaatgccctgcgcgttgcggagagt
ggtattcatagccgtgaggatatcgatcgccttcgagatgcggcttacagcgcgttcctg
atcggcgaatcgctgatgcgagcggattctcccagcgccacgctgagggagttgatcggc
tga

DBGET integrated database retrieval system