KEGG   Candidatus Koribacter versatilis: Acid345_1160Help
Entry
Acid345_1160      CDS       T00352                                 

Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acid345_1160
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acid345_1160
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acid345_1160
Enzymes [BR:aba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acid345_1160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1445537..1446322
Genome map
AA seq 261 aa AA seqDB search
MAIQFHKRPGLVAYITCGDPDVDTAIRIILAAVEAGADVIELGVPFSDPVADGPVIQAAS
ERALHGGTSVKDVLHVAREVRRHTDAGLIVFSYMNPLLRYGLEKFCADAANAGVDGVLVT
DLPVEEAGPYLAAMSKHNLDPIFLVAPTSPDARLKLIAEHSRGFVYAVSRTGVTGTRQEV
ASDARDLVKRLRQFTKLPIAVGFGVSNAEQFAEVGRFADAAVIGSAIMQRVFDNPGSEPE
AVKAFLRGLTSSMKPAAARKG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaatccaatttcacaagcgtccagggctggtcgcgtacatcacgtgcggtgatccc
gatgtggataccgcgatcaggatcattcttgcggcggtcgaggccggcgcggatgtgatc
gaactcggagtcccattcagcgatccagtcgcggatgggccggtgatccaggcggcaagc
gaacgcgcgctgcatggcggcactagtgtgaaagatgtgcttcacgttgcacgagaagta
cgccggcacaccgacgcgggattgatcgttttctcgtacatgaaccccttgctgcgttat
ggcctcgaaaaattctgcgccgatgctgcgaatgccggcgtagatggcgttcttgtgacc
gatctgccagtcgaagaagcaggaccgtacctggcggcgatgtcgaagcacaatctcgac
ccgatttttcttgttgcgccgacaagtcccgacgctcggttgaagctcatcgcagagcac
agccgaggttttgtttatgcggtttctcgaaccggtgtgaccggcacgcgccaggaagtc
gcaagcgatgctcgcgacctcgtgaaacggttgcggcaatttacgaagttgccgatcgcc
gtcggctttggggtttcaaacgccgagcagtttgcggaagtgggtcgcttcgccgacgcc
gccgtaatcggcagcgcgatcatgcagcgtgttttcgataacccgggcagcgagcccgaa
gcggtgaaggccttcctacgcggacttacttcctcaatgaaaccagcggcggcaaggaag
ggctga

DBGET integrated database retrieval system