KEGG   Candidatus Koribacter versatilis: Acid345_1267Help
Entry
Acid345_1267      CDS       T00352                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acid345_1267
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Acid345_1267
Enzymes [BR:aba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Acid345_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1538899..1539675
Genome map
AA seq 258 aa AA seqDB search
MRFVIKVGTSLIAPGGRIDTVLMRALVDQLDLERHEYLIVSSGAIASGMSKLAFSAKPKS
VRLMQACAAVGQSLLMYTYEQLFFGKKVVAQLLLSSDDFTSALRYENLQHALHELLKLGV
VPIVNENDSVSVRELVGAFGDNDELSALLATAVKADWLVLLTNVDGFYDSAGRGQKLVRT
VRRLTPKMEALCGEKSELGTGGMRSKLRAAMMASENGVQVAIANGTAPQAIRNAIERKIG
TYFPATKPAPKKRAKAAD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcgtcatcaaagtaggtaccagcctgatcgccccgggcggccgtattgatacg
gtgctcatgcgggcgctcgtcgaccagttggacctggagcggcacgaatacctcatcgtc
agctcgggcgcgatcgcttccggcatgtcgaaattggcattttctgcgaagccgaagagc
gtgaggctcatgcaagcgtgtgcagccgtgggacaaagcctgctgatgtatacctacgag
cagctcttcttcggcaaaaaagtcgtcgcacaactgctgctttcgagcgacgacttcacg
tcggctcttcgctacgagaatctgcaacacgcgttgcatgaattgctaaagcttggcgtg
gtaccgatcgtcaatgaaaacgatagtgtttccgtgcgcgaactcgttggtgctttcggg
gataacgacgagttgagcgcattgttggcgacggctgtgaaggccgactggctcgtgctt
ttgacgaacgtggatgggttctacgacagtgctggtcgcggacagaaactggtgcgcacg
gtgcggcgattgacgccgaagatggaagcgctctgcggcgaaaagagcgaactcggcacc
ggaggtatgcgatcaaagttacgcgcagccatgatggctagcgagaacggtgttcaggtt
gcaattgcaaacggcacggcaccgcaagcgattcgaaatgccatagagcggaagatcggt
acatattttccggcgacgaagcctgcccctaagaaacgcgcaaaggctgcggattaa

DBGET integrated database retrieval system