KEGG   Candidatus Koribacter versatilis: Acid345_1449Help
Entry
Acid345_1449      CDS       T00352                                 

Definition
phosphodiesterase I
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aba00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:aba00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:aba02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1750443..1751696
Genome map
AA seq 417 aa AA seqDB search
MKRLLARLCFLLLISVGAFAQSIPVITVDQPPNSAEQQKKHYVVLVSLDGFRYDYAKKYG
ATHLLEIAKHGASVPDGMIPSYPSLTFPNHYTLVTGLYPEHHGIVGNEFYDPERKAKYAL
SDKAAEADGTWYEGTPLWSLAVKQGMRSACFFWPGSVAEIAGARPTYYLRYDNSIPDERR
VEQVIAWLKLPAEQRPHFITLYYSKVDHAGHEFGPDSPQVAEAVKSVDATIGLLEENLQA
LHLPIDLIVVSDHGMAKTDPNWVTLDKYASLDGFVTVGLSLYAPSEAAAEKAYEKLKGGD
SRFNVYRRKDVPAELHFNSNPREGDPVVVAKGSWAIRATTNSYGGDKPPNIGNHGFDPRV
LPEMKAVFYAEGPDIKPGVQLQSFENVNVFPLIVELLGLDSPKVDGDPKVLSGIVKK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggcttctagctcggctgtgcttcctgctgctgatctctgttggcgcttttgcg
caaagcattcccgtcatcactgtcgatcaaccgccgaactcagcggaacagcagaagaag
cactatgtagttctggtgtcgctggatggctttcgatatgactacgcgaaaaagtatggg
gcgacgcatctcctggaaatcgccaaacatggggcgagcgttcccgacggaatgattccg
tcgtatccgtctctgacctttccgaaccactacaccttggtgaccggactgtatcccgag
caccacgggattgtgggcaacgagttttacgatccggagcgcaaagcgaagtacgcgttg
agtgacaaagcggcggaagccgatggtacgtggtacgagggcacgccgttgtggtcgctg
gcggtgaagcagggaatgcgtagtgcctgtttcttctggccgggatcggtggcggagatc
gcaggagcgcggcccacttactacctgcgttacgacaactccatcccggacgagaggcgt
gtcgagcaggtcatcgcgtggctcaagcttcctgccgagcagcgtcctcacttcatcacg
ctgtactactcgaaggtcgatcatgccggacacgaattcggcccggacagtccgcaggtt
gcggaggcagtgaagagtgtggatgcaacgattggcctgctcgaggaaaacctgcaggca
ctgcatctgccgattgacctgatcgttgtttcggaccacggcatggcgaagacggacccg
aattgggtcacgctcgacaaatatgcttccctcgacggcttcgtgacggttgggctgagc
ctgtacgcaccctcggaagctgccgccgaaaaggcgtacgagaagctgaagggcggggat
tcgcgcttcaacgtctaccggcggaaggacgtgccggctgagctgcatttcaacagcaat
ccgcgcgaaggagatccggtggtggttgcaaagggttcgtgggcgatccgcgcgaccaca
aactcctacggcggagacaagccaccgaatattggcaatcatgggttcgatccgcgtgtg
ctgccggagatgaaggcggtcttttacgcggaggggcccgacatcaaacccggagttcag
ttgcagagcttcgagaacgtaaacgtgttcccgttgattgtggaactgctaggtcttgat
agcccgaaggttgacggtgaccccaaagttctttcgggaattgttaagaaatag

DBGET integrated database retrieval system