KEGG   Candidatus Koribacter versatilis: Acid345_1459Help
Entry
Acid345_1459      CDS       T00352                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD+)
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acid345_1459
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Acid345_1459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1761928..1763445)
Genome map
AA seq 505 aa AA seqDB search
MATTTAETAKATVYKNLIDGEWVESKSGQTFENLNPADTREVVGIFQRSGKEDVEHAIDA
ASEAYKKWRLVPAPRRAELLFKAAAILEQRKEKYSQEMTREMGKVIKETRGDVQEAIDAG
YYNAGEGRRMFGPTTPSELPNKFAMAVRQPLGVCAMITPWNFPMAIPSWKLFPALVCGNT
AVIKPAQDTPLSTFNFVQALNDAGVPKGVINIVTGYGGEVGTPMTEHPEVKAVSLTGSTA
VGRIVGQAAAKSFKHCSLELGGKNPMIVLDDANLDLALEGALWGSFGTTGQRCTATSRII
LQKGIYKKFADELVARARKLKVGNGLDETVDMGPAVNENQMNTDLKYIEIGKGEGAKLAH
GGHRLDKGDYAHGWFLEPTIFTDVNHKMRIAQEEIFGPVVALIPCDDLDEAIEIANGIEY
GLSSAIYTRDVNKSFRAMRDLHAGITYVNAPTIGAEVHMPFGGVKATGNGHREGGIGALD
FYTEWKAIYVDYSDTLQRAQIDNRE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccactaccgcggaaaccgcgaaggcgaccgtttacaagaaccttattgatggc
gaatgggtcgagtcgaagtccggccagaccttcgagaacctcaacccagccgatacccgc
gaagtggttggcatcttccaacgcagcggcaaagaagacgttgaacacgccattgacgcc
gccagcgaagcctataagaagtggcgtctcgtgccggcaccacgacgtgccgagctcctc
ttcaaggctgccgctatcctcgagcagcgtaaggaaaagtacagccaggaaatgacccgc
gagatgggcaaggtcattaaagagacccgcggcgacgtccaggaagccatcgacgctggt
tactacaacgccggcgaaggtcgccgcatgttcggaccgaccacgccgtcggagctgccg
aacaagttcgccatggccgtccgccagccactgggcgtctgcgccatgatcaccccgtgg
aatttcccgatggcgatcccgtcatggaagctcttccccgcgctcgtctgcggcaacacc
gccgtgatcaagccagcccaggacacgccgctttcgactttcaacttcgtccaggcgctt
aacgatgccggcgtccccaagggggtaatcaacatagttaccggctacggtggcgaagtc
ggcaccccgatgaccgagcaccccgaagtgaaggccgtatcgctaaccggttccacagcg
gtcggtcggatcgttggccaagccgcagcgaagagcttcaagcactgctcgctcgaactc
ggcggcaagaaccccatgatcgtcctcgacgacgccaacctcgatctggctctcgaaggc
gctctctggggatcgtttggcaccaccggacagcgctgcaccgcgaccagccgcatcatt
cttcagaagggcatttacaagaaattcgccgacgaactcgtcgcccgtgccaggaaattg
aaagttggcaatggtctcgatgagaccgttgacatgggacccgcagtgaacgagaaccag
atgaacaccgacctcaaatacatcgagatcggcaagggtgaaggcgccaagctcgcgcac
ggcggccaccgcctcgacaagggcgattacgcccacggctggttcctggagccgacgatc
tttaccgacgtcaaccacaagatgcggattgcgcaggaagagatctttgggcctgtcgtt
gcgctgatcccgtgcgacgacctcgatgaagccatcgagatcgccaacggcatcgagtac
ggcctctcgtccgcgatctacacacgcgacgtcaacaagtcgttccgcgccatgcgcgat
ctccatgccggcatcacctacgtcaatgcaccgacgatcggcgcggaagttcacatgccc
ttcggcggtgtaaaggctacaggaaatggccatcgcgaaggcggcatcggcgccctcgac
ttttacaccgagtggaaggcgatctacgtggattacagcgacacgctccagcgtgcacag
atcgacaaccgggagtag

DBGET integrated database retrieval system