KEGG   Candidatus Koribacter versatilis: Acid345_1486Help
Entry
Acid345_1486      CDS       T00352                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acid345_1486
Enzymes [BR:aba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Acid345_1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1802522..1804051
Genome map
AA seq 509 aa AA seqDB search
MKFPRSAGILLHPTSLPGPYGIGDFGTSAYRFADFLHSAGMKIWQVLPLNPTGYGDSPYQ
SFSAFAGNPLLLSLDELHKQGLLSEHDLRQATFDNDGDIDFGAVIPRKFASLNKAAVAFY
GKSGEANLDFQQFVAANSAWLDDYALFMAAKDAHDLVIWTKWDADLAARKPEALARWRKQ
LSNEIAAYKFWQFEFFRQWRALKSYANDRGIRIMGDIPIYVAHDSADVWARPDLFWLDAK
GNPLKVAGVPPDYFSATGQLWGNPIYRWDLMRDNGYKWWIERFRAALTMFDLVRVDHFRG
FEAYWEIPGGEPTAMHGQWVKGPGAELFEVVSTALGDLPIVAENLGVITPEVEAIRHQFG
FPGMAIAQFAFSIDPMAPTFRPHNYERQLVAYTGGHDNDTMFGWWRSGVADSTRTQEEVD
REHNDAAAYFGVTLDEMDRSVNWIYIRAVMMSVADTVLFPMQDVIGLGGQARMNLPGSLG
RNWKWRVCKEEQRFEHAKRLDEFAKLYDR
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttccgcgctccgccggcatcctgctccacccgacgtcgctgcccggcccctac
ggcatcggcgacttcggcaccagcgcctatcgcttcgccgactttctgcactcggccggc
atgaagatctggcaggtgctgccgttaaaccccacaggttacggcgactctccgtaccag
tcgttctcggccttcgctggaaatcctcttcttctcagtctcgacgaactgcacaagcaa
ggcctgctcagcgagcatgacctccgccaggcgaccttcgacaacgatggcgacatcgat
ttcggcgcggtcattccgcgcaaattcgcctccctcaacaaagcggccgtcgccttttat
ggaaaatccggcgaggccaatctcgacttccagcaattcgttgccgccaattctgcgtgg
ctcgatgattacgcgctcttcatggccgctaaagacgcccacgatctcgtcatctggacc
aagtgggacgctgatctcgccgcccgtaagccggaagcgctggctagatggcgcaagcag
ctctctaacgaaatcgcggcctacaagttctggcaattcgaattcttccgccaatggcgc
gccttgaagtcttatgccaacgatcgcggcatccgcatcatgggtgacatccccatctac
gtcgcacacgacagcgccgacgtttgggcgcgtcccgatctcttctggctcgacgcgaaa
gggaacccgctgaaggtcgccggcgttccccccgactacttcagcgccaccggccagctc
tggggaaatccgatctatcgctgggacctgatgcgcgacaacggctacaagtggtggatc
gagcgcttccgcgccgcgctcaccatgttcgacctcgtccgagtggaccacttccgaggc
ttcgaggcctactgggagatcccgggcggcgagcccaccgccatgcatggccaatgggtg
aaaggccccggcgccgaactcttcgaggtcgtgagcactgcgctcggcgatctcccgatc
gtcgccgagaaccttggcgtcataacgcctgaggtcgaagctatccgtcaccagtttgga
ttcccgggcatggcgattgcgcagttcgccttcagcattgatcccatggcgcccacgttc
cgtccgcacaattacgaacgccaactcgtggcctacaccggcggccacgacaacgacacc
atgttcggctggtggcgctccggcgtcgccgacagcacccgcacccaggaagaggtcgac
cgcgagcacaacgacgccgcagcctatttcggcgtcaccctcgacgaaatggaccgcagc
gtcaactggatatacatccgcgccgtcatgatgtccgtcgccgacaccgtcctctttccc
atgcaggacgtcatcggcctcggcggccaggcccgcatgaatctccccggcagcctcggt
cgtaactggaaatggcgcgtgtgcaaggaagaacaacgtttcgaacatgcgaagcgcctc
gatgagttcgccaaactctacgaccgctag

DBGET integrated database retrieval system