KEGG   Candidatus Koribacter versatilis: Acid345_1623Help
Entry
Acid345_1623      CDS       T00352                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid345_1623
   01230 Biosynthesis of amino acids
    Acid345_1623
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid345_1623
   00030 Pentose phosphate pathway
    Acid345_1623
   00051 Fructose and mannose metabolism
    Acid345_1623
   00052 Galactose metabolism
    Acid345_1623
  Energy metabolism
   00680 Methane metabolism
    Acid345_1623
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Acid345_1623
Enzymes [BR:aba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Acid345_1623
Protein phosphatases and associated proteins [BR:aba01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Acid345_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1967411..1968610
Genome map
AA seq 399 aa AA seqDB search
MANVTKKKGVIGILTGGGDVPGLNPAIRGVTFRALREGYDVIGLRRGWGGLVDIVRDKDH
DNSENFVHLSETVVNRAARTGGTFLHTSRTNPSRVAKDKVPAHLQGQFNAEKNDLTSEML
KNLEWLGIDYLIPIGGDDTLSYGVRLYQEGVKVVAIPKTMDNDVPGTDYCIGFSTCVTRT
IQMVNSLRTSAGSHERFLVVEVFGRYAGFTALLPTMAGAANRCVIPEFKFNIESLAELMA
NDRKRNPSRYSVVLISEGAMFEGGEMVFQSESTDAFGHKKLGGIGDLIAAKLTELSPKYC
GKTVNCLTQKLGYLVRGGDPDAIDSIVPMAYGNLALDLILNKIHGRLVVLKNGRYDNVPV
DVVTSSKKVIKVKEHYNTERLRPHYESFEMKPLFIMTSE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatgtaactaagaagaagggcgtgattggaatcctgaccggcggcggcgatgtg
ccgggtttaaaccctgcgatccgcggcgtgacgttccgcgcgttgcgcgaggggtatgac
gtgatcggcctgcgccgcggttggggtgggctggtggacattgtccgcgacaaggaccac
gacaatagcgagaacttcgttcatctttcggagactgtggtgaaccgggcggcgcgtacc
ggcggcacctttctgcatacctcgcgtaccaacccgagccgcgtggcaaaggacaaggtt
ccggcgcatctccaaggccaattcaacgccgagaagaacgacctcacatcagaaatgttg
aagaatctggaatggctggggatcgactacctgattccaatcggcggcgacgacacgttg
agctatggcgtgcgcctctatcaagaaggggtgaaggtcgttgcgattccgaagacgatg
gacaacgatgtcccgggcacggactactgcatcggcttcagcacctgcgttacgcgcacc
atacagatggtgaacagcctgcgcacctcggctggttcgcatgagcgctttctcgtggtc
gaagtattcggacgctacgccggatttaccgcgctgctgccgacgatggcaggcgccgcc
aaccgctgcgtcattccggaattcaagttcaatatcgagagcctcgcagaactgatggcg
aacgatcgcaagcgcaatccgagccgttactcggtagtgctgatctccgaaggcgcgatg
ttcgaaggcggcgagatggttttccaaagcgaatccactgacgcattcgggcataagaaa
ctcgggggcattggcgatttaattgccgcgaagctgacagagctctcgccgaaatactgc
ggcaagaccgtcaactgcctgacgcagaagcttggatatctcgtgcgcggcggcgatccg
gatgcgatcgactccatcgtgccgatggcgtacggcaacctggcgctcgacctcattctc
aataagatccacggacggttggttgtattgaagaatgggcgttacgacaacgtgccggtg
gatgtggtgacttcttccaagaaagtgatcaaggtgaaggaacactacaacacggagcgt
ctgcgcccgcactatgagagcttcgagatgaagccgctgttcattatgacgagcgagtag

DBGET integrated database retrieval system