KEGG   Candidatus Koribacter versatilis: Acid345_1677Help
Entry
Acid345_1677      CDS       T00352                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Acid345_1677
  Lipid metabolism
   00561 Glycerolipid metabolism
    Acid345_1677
   00600 Sphingolipid metabolism
    Acid345_1677
Enzymes [BR:aba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Acid345_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2028162..2029388)
Genome map
AA seq 408 aa AA seqDB search
MRRPGPQMKRFVASIPLVIIFLSIIAAAQESPKPPDINAYAPTPPMGWNTWNKFACNVDE
KLIRGAADALVSSGMKDAGYHYLVIDDCWQVSRDGKGNIVADPQRFPSGIKALAAYVHHK
GLKFGIYSDIGTKTCQGRPGSRGHEFQDALQYAAWDVDYLKLDWCNTGTQNAPASYKTMR
DAIDATGRPIVLSICEWGKSKPWLWAKDTGNLWRTTDDIQDRWAGKKKWDEASCCSNGML
DILDEEADIASYAGPGHWNDPDMLEVGNGGMTNVEYRSHFSLWAILAAPLMAGNDLTNMR
PEIREILTNKEVIAVDQDPLGKQGVRAAKNGDLEIWSKVLADGSRAAVLLNRSASEQEIT
ARWIDLGYPATLSVRVRDLWAHKDLGSFKDKFSAKVPSHGVVMIHLQP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
ttgcggaggcccggcccgcagatgaaacgcttcgtcgcatccatccctctcgtaataatt
tttcttagcatcattgctgccgcgcaagaatccccaaagccgccggacatcaacgcctac
gcgccaaccccgccgatgggatggaacacgtggaacaagttcgcctgcaatgttgacgag
aaactcattcgtggcgccgccgatgcactcgtctcctctggcatgaaagacgctggttac
cattacctcgtcattgacgactgctggcaagtcagccgcgacgggaaaggcaacatcgtt
gccgatccacaacgattcccttccggcatcaaggccctcgccgcgtacgtccaccacaaa
ggactgaaattcggtatctactccgacatcggcaccaagacttgccaaggccggcccgga
agccggggccatgaatttcaagacgccctgcaatacgccgcatgggatgtcgactatctc
aaactcgattggtgcaacactggcacccagaacgccccagcctcgtacaaaaccatgcgc
gatgcgattgatgccacgggccgtcccatcgttctaagcatctgcgaatggggcaagagc
aagccgtggctctgggccaaagacaccggtaatctctggcgcaccaccgacgacattcag
gatcgctgggccggcaagaaaaaatgggatgaagcctcatgctgctccaacggcatgctc
gacattctcgatgaagaagccgacatcgccagttacgccggtcccggacactggaacgat
cccgacatgctcgaggtcggcaacggcggcatgaccaacgtcgaatatcgttcccacttc
agcctatgggcaatcctcgctgcgcctctcatggccggcaacgatctcaccaacatgcgc
cccgaaattcgcgaaatcttgaccaacaaagaagtgatcgccgtagatcaagacccgctc
ggcaagcagggcgttcgcgcagcgaagaacggcgatctcgaaatctggagcaaagtgctt
gccgacggatctcgcgccgctgtcctcctcaaccgcagtgcatcggaacaagagatcacc
gcgcgatggatcgacctcggttatcccgcgacactctccgtgagggtccgagacctctgg
gcgcacaaagatctcggttctttcaaagacaagttttccgccaaagttccatcgcacggt
gtcgttatgattcacctgcaaccgtaa

DBGET integrated database retrieval system