KEGG   Candidatus Koribacter versatilis: Acid345_1688Help
Entry
Acid345_1688      CDS       T00352                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Acid345_1688
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Acid345_1688
Enzymes [BR:aba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Acid345_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2046502..2048937
Genome map
AA seq 811 aa AA seqDB search
MPKRRLSVLFVLTALFFFSSSFSYAGDDIPEAAWRRPIGAPLQNAGGKKPGLPIIDDGYW
QGAPVGGFGAGTFSRTYRGNFERWHVKAGIHKYQNVPANQFAVFAQADGDAAVAQVLSTQ
KPEHGELSSWNWTYPVGAGDYAALYPKSWFAYKSPQLPITLTLEQFSPVIPDNYKESSYP
VAVYNWYVTNPSQKRVTVSILFSWTNMVGWFRDTTTGFGAALNSQDINHYKSEAIKSSQM
QGIVFDRLRSEPVSDEWDGQFAIASLAGSGVEISYLTTYRPSGDGSDVWTPFAKDGRLPN
VAAGLASSGDSLAGAIAVRFTLAPGEKRTIPMALAWDLPFIQFGSGRKWARHYTRFFDRF
GTNAWKLARTALEQGNDWSRQIDAWQKPYISDESKPLWYRGMLFNELYDLVDGGTMWAHE
VGTPGNPHHPSAVKDDSFSYLECFDYAYYGTLDVRFYGSFPLAKFWPEIEKQEMREYADT
IPENIDQKYIWAWKSDNEHKLEPTQRKVAGSAPHDLGSPLEDALILPNQYNYQSVSFWKD
LNSKYVLMVWRDYVMSGSKDKAFLQYNYNAVKQSMQFLRQFDKNNDGLIENDGYPDQTYD
NWSARGESAYSGSLYLAALRATEEMAKLLGDQRTAADTAALFKRAQDSFVKKLWNGTYFN
YDVGSSYKDAIMAEQLAGQWYASLTGLGDLVPRDMQHSALKKVYDFNVMKLQNGTMGALN
GISASGEVLKDNEQTEEVWTGVTFAVAATMLQNGLREEGFNTAKGVYNVVYDQKGYWFRT
PEAYDTNGMYRASMYMRPGAIWSMEMVPAAK
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagcggcgactgtcagtcctattcgtgctaaccgccctatttttcttcagctcc
agcttttcatatgccggagatgatattccggaggcggcgtggcggcgacccatcggcgcg
ccattacaaaatgccggtggcaagaagccgggattaccaattattgacgacggttattgg
cagggcgcgccagtcggtggctttggggctggcactttttcccgaacctatcgcggaaat
ttcgaacgctggcatgtgaaagcgggaattcacaaatatcagaatgttccggcgaatcag
ttcgcagttttcgcgcaagcggacggcgatgctgcggtggcgcaggtgctctccacgcaa
aagccggagcatggcgagctctcttcgtggaattggacgtacccggttggcgccggcgac
tacgctgcgctctatccgaagtcctggtttgcatacaagtcgccacaattgccgattact
cttacgctcgaacagttttcgccggtgatccccgataactacaaggaatccagctatccg
gttgcggtctacaactggtacgtcacaaatccttcgcagaaacgcgtgacggtctcgatc
ctgttttcgtggacgaatatggtcgggtggttccgcgatacgacaacgggcttcggtgcg
gcgctgaattcacaagacatcaaccactacaaatctgaggcgataaagtcgagccagatg
cagggcatcgttttcgatcgactgcgctcggagccggtttcggatgagtgggacggccag
ttcgcgattgcttcgcttgcaggaagtggcgttgaaatttcttacctgacgacgtatcgg
ccctcgggtgacggttcggacgtatggacgccgttcgcgaaggacgggcgcttgcccaac
gttgcggcagggcttgccagcagcggagactcgctggctggagcgatcgccgttcgattc
acgttggcgcccggagaaaagcggacgattccgatggcgctcgcctgggatctgccgttc
attcagttcggctcgggccgtaaatgggcgcgccactacacgcgtttcttcgatcgcttc
ggcacgaacgcctggaaactcgcgcgcaccgcgctcgagcaagggaatgactggagccgc
cagattgatgcgtggcagaagccgtatatcagcgatgaatcgaagccgctttggtatcgt
ggcatgctctttaatgagctttatgaccttgtggatggcggcacgatgtgggcgcacgaa
gtcggcacgcctggcaatccgcatcatccctcagcggtgaaggacgatagcttcagctac
ctcgagtgctttgactacgcttattacggaacgctcgacgtccgcttctatggatcgttc
ccactcgcgaagttctggccggagatcgagaagcaggagatgcgcgagtatgccgacacg
atcccggagaacatcgatcagaaatacatctgggcttggaagtcggacaatgaacacaaa
ctggaaccgacgcagcgcaaggtcgctggatctgcgccgcatgatttaggcagcccgctg
gaagacgcgctgattctgccgaaccagtacaactaccagagcgtgtcgttctggaaggac
ttgaacagcaagtatgtgttgatggtgtggcgcgactatgtcatgtccggcagtaaggac
aaagcgtttctgcaatacaactacaacgccgtgaagcagtcgatgcaattcctgcgtcag
ttcgacaagaacaacgacgggctcatcgaaaatgacggatatcccgaccagacttacgac
aactggtcagcacgcggcgagagcgcttatagcgggagcctgtatctcgcggctctgcgg
gccacggaggagatggccaaacttcttggcgaccagcgcaccgcggctgacaccgctgca
ctcttcaagcgcgcgcaggacagctttgtcaagaagctctggaacggcacgtatttcaat
tacgacgtcggcagctcctacaaagacgccattatggccgaacagttggcagggcagtgg
tatgcctcgctgaccggccttggcgacctcgtgccacgagatatgcaacattccgcgttg
aagaaggtttatgacttcaacgtgatgaaattgcaaaatggcacgatgggcgcactgaat
ggcatcagcgcatctggagaagtgttgaaggacaatgagcagaccgaagaggtctggact
ggcgtcaccttcgcagttgcggcgacgatgctgcagaacggattgcgcgaagagggcttc
aacaccgcgaagggcgtgtacaacgtcgtttacgaccagaagggctattggttccgaacg
cctgaagcatacgacaccaacggaatgtatcgcgcgagcatgtatatgcgtccgggcgcg
atctggtcgatggaaatggtgccggctgcgaagtag

DBGET integrated database retrieval system