KEGG   Candidatus Koribacter versatilis: Acid345_1740Help
Entry
Acid345_1740      CDS       T00352                                 

Definition
squalene cyclase
Orthology
K06045  
squalene-hopene/tetraprenyl-beta-curcumene cyclase [EC:5.4.99.17 4.2.1.129]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Sesquiterpenoid and triterpenoid biosynthesis
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    Acid345_1740
Enzymes [BR:aba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.129  squalene---hopanol cyclase
     Acid345_1740
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.17  squalene---hopene cyclase
     Acid345_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2111617..2113590
Genome map
AA seq 657 aa AA seqDB search
MDDRHIQSEITFGKIDGIRERIQQAMDAAKRYLFSKQDPEGFWCGELEADTTLQSDYIVM
HTLLGTGDPVKMQKAGKQILQHQNPDGGWNIYPDGPSNISAAVKAYFSLKLIGHKPDEPE
MTKAREWILAHGGVTACNTFSKMYLCFFGQYDYDTVPAIPPEIVLFPNWFWFNLYEISSW
SRGILVPLAICYAKKPFKKIPDEANIDELFVEGRHANLHLTWDKKPFSWRNFFLVLNNMV
HFFERVHVRPLRKLAMKRAEKWMLERLEMSDGLGGIYPAILNSIIALRALGYSTDDPQVI
RAMDEFEKLGIEEDDTFRMQPCMSPVWDTAYALYALGEAGVPGSDPRMQKAAEWMLKKQV
THKGDWAVKVRNVQPGGWYFEFNNEFYPDVDDTAQVILSLNHVRTSNERYQDDTVKRALD
WQLAMQCKNGGWASFDKDNNKMVFQYIPFADHNAMLDPATVDITGRVLEALSHHGYSLKD
KVVQRAVKFIQSEQEPDGSWFGRWGVNYIYGTMLCLRGLAAVGVDHHEPMVQQAAEWLRM
VQNPDGGWGESVGSYDDPKLRGQGPSTASQTAWAVMGLLAANDLRSDSVTRGIAWLLENQ
KPNGSWWEKWITGTGFPRVFYLKYTMYAEYFPLIAFAEYLRRLNTPLDEKVKLGPQA
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggacgacagacatattcaatcggaaataacgttcggcaagattgacggcatccgcgag
cgcattcaacaggcgatggatgccgccaaacggtatctcttctcgaagcaggatcccgaa
ggtttctggtgcggtgaactcgaagccgacaccacgctgcaatccgattacatcgtgatg
catacactgctcggcaccggcgatccggtgaagatgcagaaggccgggaagcagatcctg
cagcaccagaatccagacggcgggtggaatatctaccccgacggcccttcgaacatcagc
gcggctgtgaaggcgtatttctcgctcaagctgatcggtcacaagcccgatgagccggag
atgacgaaggcccgggagtggatcctggcccatggcggcgtgactgcctgcaacacattt
tcgaagatgtatctctgctttttcggccagtacgactacgacacggttccagctatcccg
ccggagatcgtgctctttccgaactggttctggttcaacctgtacgagatatcgtcgtgg
tcgcgcggcattcttgtcccgctcgcaatctgctacgcgaaaaaaccattcaagaaaatt
cccgacgaagcaaacatcgacgagctgttcgtcgaagggcgtcacgccaatttgcatttg
acctgggacaagaagcctttttcgtggcggaacttcttcctcgtgcttaacaacatggtg
cactttttcgagcgcgtgcacgtgcgtccgctgcgcaagctcgcaatgaagcgggcagag
aaatggatgctcgagcgcctcgagatgagtgacggactcggtgggatctatcctgcgatt
ttgaattcaatcattgcgctgcgcgcacttggatattccacggacgatccgcaggtgatc
cgtgcgatggacgagttcgagaagctcggtatcgaggaagacgacacattccgcatgcaa
ccgtgcatgtcaccagtgtgggacacggcatacgcgctgtatgcgcttggcgaagccggc
gtgccgggcagcgatccacgcatgcaaaaggccgctgagtggatgctgaagaagcaggtg
acgcacaagggcgattgggcggtgaaagtccgcaacgtgcagccgggtggctggtacttc
gagttcaataacgagttctatcccgacgtggacgacaccgctcaggtgattctgtcgctg
aaccacgtgcggacatccaacgaacgctaccaggacgacaccgtcaagcgcgctctcgac
tggcaactcgccatgcagtgcaagaacggcggctgggcctcgtttgataaagacaacaac
aagatggtcttccagtacatcccgttcgctgaccacaacgccatgctcgatccggcgacg
gtcgacattacgggacgcgtcctggaagccctctcgcatcacgggtactcgctgaaggac
aaagttgtgcagcgcgccgtcaagttcattcagagtgagcaagaacctgacggttcctgg
tttggtcgctggggcgtgaactacatctacggcaccatgctttgcctccgcggactcgcg
gcggtcggcgtggatcaccacgaacccatggtgcaacaggcagccgaatggttgcgtatg
gtgcagaaccccgacggtggttggggcgaaagcgtgggctcatacgacgatccgaaattg
cgcgggcagggaccgagcacggcctcgcagacagcatgggctgtaatggggttgctggcg
gcgaatgatctgcggagcgattcggtgacgcgcggtatcgcgtggctgcttgagaaccaa
aagccgaatggatcttggtgggaaaagtggatcactggcaccggtttcccgcgcgtgttc
tacctcaaatacaccatgtacgccgagtatttcccgctcatcgcttttgccgagtatctg
cggcgtttgaatacgccgctcgatgagaaggtgaagctcggaccacaggcgtag

DBGET integrated database retrieval system