KEGG   Candidatus Koribacter versatilis: Acid345_1821Help
Entry
Acid345_1821      CDS       T00352                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Acid345_1821
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acid345_1821
Enzymes [BR:aba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Acid345_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2201493..2202452
Genome map
AA seq 319 aa AA seqDB search
MQITEEPKIRIESSRPSMNLRHVVESQQFTVPLLMELFDRTRLMERIVARGGTLDYQNRI
LASLFYEPSTRTRFSFEAAMHRLGGRVLSTEHARYFSSAIETEQVEDSIRIIGSYSDVIV
IRHNQEGGARRAAAVSPVPVINAGDGEGGQHPTQALLDLFTIYRERPIEGLSVAFIGELD
RGRTVRSLAYLLAKFDRVKIYFVSPPELQMKPDILEYLDRHEVKYEIEADINKVVGEVDV
VYQTRIRPDRVSSVASQMRYAIDSSVLPKLKPNAMILHPLPRTVELDKTVDSDPRAFYFR
QAANGLVVRMALLTMLLDR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcaccgaagagcccaaaattcgtatagaaagcagtcgtcccagcatgaacctc
cgccacgtcgtcgagtcgcaacaattcactgtgcctttgttgatggaactcttcgatcgc
acacggctgatggaacgcatcgtggcgcgcggcgggacgctcgactaccagaaccgcatc
cttgccagcttgttttacgagccttcgacgcggactcggttctcgttcgaagccgcgatg
catcgactcggcggacgggtgctctctaccgagcatgcgcggtatttctcgtcggcgatc
gagaccgagcaggtggaggattcgattcgcatcatcggcagctatagcgatgtgatcgtg
attcgacacaaccaggaaggcggggcgcggcgagcggcagcagtgtcgccagttccggtc
atcaatgccggcgacggcgaaggcgggcagcatccgacgcaggcacttctcgatttgttc
accatctatcgcgaacggcctattgagggactgagcgtggcgttcatcggcgaactcgat
cgcgggcggacggttcggtcgctggcgtatctgctggcgaagttcgatcgcgtgaagatc
tacttcgtcagcccgccggaattgcaaatgaagcctgacattctcgagtacctcgaccgt
catgaggtgaagtacgagatcgaggcggacatcaataaagtcgtgggcgaagtggacgtc
gtgtaccagacgcggattcggccagaccgcgttagcagcgtggcgagccaaatgcgctat
gcgattgactcaagcgtgctgccgaaactgaaaccgaatgcgatgatcctgcacccgctg
ccgcgcacggtggaactcgacaagaccgtggattcggatccgcgggcgttctacttccgg
caggccgccaacggcctggtggtgaggatggcgctgctgacgatgcttttagatcgataa

DBGET integrated database retrieval system