KEGG   Candidatus Koribacter versatilis: Acid345_1872Help
Entry
Acid345_1872      CDS       T00352                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aba00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:aba00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2252507..2252986
Genome map
AA seq 159 aa AA seqDB search
MGLYDLSATLNNGKEKKLSDYKGEVLLVVNTASECGFTPQYKGLQELYEKYKNQGFEILG
FPCDQFGHQEPGSDKEIASFCEVNYGVTFPIFSKIEVNGANEHPVYKFLKSEKGGLLTNN
IKWNFTKFLVDKQGNVVDRYAPQTIPARIAADVEKLLST
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgtacgatttgtctgccacgctgaataacggcaaggaaaagaagctctccgac
tacaagggcgaagtgttgctcgttgtgaacacggctagcgaatgcggtttcacgccgcaa
tacaagggtctgcaagaactctacgagaagtataagaaccagggcttcgagatcctcggc
ttcccctgcgaccagttcggccaccaggagccgggcagcgacaaagagatcgcttctttc
tgcgaggtcaactacggcgtaacgttcccgatcttctcgaagatcgaagtgaacggggcg
aacgagcatcccgtgtacaagttccttaagtccgaaaaaggcggcctgctcaccaacaac
atcaagtggaacttcaccaagttcttggtagataagcagggcaacgtggtggaccgctac
gctccgcagacgatcccggcgcgcatcgcggcggacgtggagaagctgttaagcacctag

DBGET integrated database retrieval system