KEGG   Candidatus Koribacter versatilis: Acid345_1872Help
Entry
Acid345_1872      CDS       T00352                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Acid345_1872
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Acid345_1872
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Acid345_1872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2252507..2252986
Genome map
AA seq 159 aa AA seqDB search
MGLYDLSATLNNGKEKKLSDYKGEVLLVVNTASECGFTPQYKGLQELYEKYKNQGFEILG
FPCDQFGHQEPGSDKEIASFCEVNYGVTFPIFSKIEVNGANEHPVYKFLKSEKGGLLTNN
IKWNFTKFLVDKQGNVVDRYAPQTIPARIAADVEKLLST
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgtacgatttgtctgccacgctgaataacggcaaggaaaagaagctctccgac
tacaagggcgaagtgttgctcgttgtgaacacggctagcgaatgcggtttcacgccgcaa
tacaagggtctgcaagaactctacgagaagtataagaaccagggcttcgagatcctcggc
ttcccctgcgaccagttcggccaccaggagccgggcagcgacaaagagatcgcttctttc
tgcgaggtcaactacggcgtaacgttcccgatcttctcgaagatcgaagtgaacggggcg
aacgagcatcccgtgtacaagttccttaagtccgaaaaaggcggcctgctcaccaacaac
atcaagtggaacttcaccaagttcttggtagataagcagggcaacgtggtggaccgctac
gctccgcagacgatcccggcgcgcatcgcggcggacgtggagaagctgttaagcacctag

DBGET integrated database retrieval system