KEGG   Candidatus Koribacter versatilis: Acid345_1973Help
Entry
Acid345_1973      CDS       T00352                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  
recombination protein RecR
Organism
aba  Candidatus Koribacter versatilis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Acid345_1973
DNA repair and recombination proteins [BR:aba03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Acid345_1973
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Acid345_1973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2364841..2365440)
Genome map
AA seq 199 aa AA seqDB search
MSKFAEPMARLIDELKKLPGVGNKSAQRLAFHILRSSNDDAELLADAVRDVKAKLRLCSI
CNNITDVDPCTYCANPTRNQQVICVVEEPTNISAVEKTRHFNGVYHVLHGALSPLHGVGP
EHLRISNLIKRVEGGKAEEVILATNPTVEGEATATYLSKILKAEGVRVTRIATGVPVGSD
IEYADEVTMQKAMEGRREL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgtccaagtttgccgagccgatggcgcggttgattgacgaattgaagaagctgccgggc
gtcggcaataagtcggcgcagcgcctggcgtttcatatcctgcgctccagcaacgacgac
gccgaactgctggcggatgccgtccgcgacgtgaaggccaaactccggctctgttccatc
tgcaacaacatcaccgatgtcgacccctgcacctactgcgcgaaccccacgcggaaccag
caggtcatctgcgtagtggaagaaccgaccaatatttctgccgtcgaaaagacccgccat
ttcaatggcgtataccatgttcttcatggagcactttcacctttgcacggggtaggtccg
gagcatttgcggatcagcaacctgatcaaacgggtggagggcggcaaggcagaagaggtc
attctcgcgaccaatccgacggtcgagggtgaggcgacggcgacgtatctgtcgaagatc
ctcaaggctgagggcgtacgggtgacgcggatcgcgaccggcgtccccgtcggcagcgac
atagagtacgccgacgaagtgaccatgcagaaggcgatggaaggacgacgggagctttag

DBGET integrated database retrieval system