KEGG   Candidatus Koribacter versatilis: Acid345_2208Help
Entry
Acid345_2208      CDS       T00352                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00790  Folate biosynthesis
aba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Acid345_2208
Enzymes [BR:aba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Acid345_2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABF41209
JGI: Acid3452208
UniProt: Q1IPJ1
Position
complement(2627959..2628558)
Genome map
AA seq 199 aa AA seqDB search
MKTEKEPTTLTSASNEELVAELLQRIGEDPKREGLLRTPERYAKALKFLTKGYDEDPETV
LNGALFTVTYDEMVIVKDIEMFSLCEHHLLPFFGKVHIAYIPNGKVIGLSKLPRLVEVFA
RRLQVQERLTTEIAQTIERVIEPLGVGVIIEARHLCMMMRGVEKQHSSTVTSAMLGAFRA
PQTREEFLSLVRNSKTNGF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgaaaaagaacccacaaccctgaccagcgcgagcaacgaagagctcgtcgct
gaacttttgcagcgaattggcgaagatccgaagcgtgaaggcctgctgcgtacgcccgag
cgatatgccaaagcgctgaagttcttgaccaagggctacgacgaagatcccgagaccgtg
ctcaacggcgcgctcttcaccgtcacttatgacgagatggtcatcgtcaaagacatcgag
atgttcagcctctgcgaacatcacctgctgccgttcttcggtaaggtacatatcgcgtat
atcccaaacggcaaggtgatcgggttgagcaagctgccgcgcctggtcgaagtcttcgct
cgccgcctgcaggttcaggagcgtctgacgaccgagatagcacaaacgattgagcgcgtg
atcgaaccgctgggcgtaggcgtgatcatcgaagcccgccacttgtgcatgatgatgcgg
ggcgtggaaaaacagcactcatccacagtgacttcagctatgctgggggcgtttcgtgcg
ccgcaaacccgcgaggagttcctctcgctggtgcgcaattctaagaccaacggcttctag

DBGET integrated database retrieval system