KEGG   Candidatus Koribacter versatilis: Acid345_2208Help
Entry
Acid345_2208      CDS       T00352                                 

Definition
GTP cyclohydrolase
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aba00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2627959..2628558)
Genome map
AA seq 199 aa AA seqDB search
MKTEKEPTTLTSASNEELVAELLQRIGEDPKREGLLRTPERYAKALKFLTKGYDEDPETV
LNGALFTVTYDEMVIVKDIEMFSLCEHHLLPFFGKVHIAYIPNGKVIGLSKLPRLVEVFA
RRLQVQERLTTEIAQTIERVIEPLGVGVIIEARHLCMMMRGVEKQHSSTVTSAMLGAFRA
PQTREEFLSLVRNSKTNGF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgaaaaagaacccacaaccctgaccagcgcgagcaacgaagagctcgtcgct
gaacttttgcagcgaattggcgaagatccgaagcgtgaaggcctgctgcgtacgcccgag
cgatatgccaaagcgctgaagttcttgaccaagggctacgacgaagatcccgagaccgtg
ctcaacggcgcgctcttcaccgtcacttatgacgagatggtcatcgtcaaagacatcgag
atgttcagcctctgcgaacatcacctgctgccgttcttcggtaaggtacatatcgcgtat
atcccaaacggcaaggtgatcgggttgagcaagctgccgcgcctggtcgaagtcttcgct
cgccgcctgcaggttcaggagcgtctgacgaccgagatagcacaaacgattgagcgcgtg
atcgaaccgctgggcgtaggcgtgatcatcgaagcccgccacttgtgcatgatgatgcgg
ggcgtggaaaaacagcactcatccacagtgacttcagctatgctgggggcgtttcgtgcg
ccgcaaacccgcgaggagttcctctcgctggtgcgcaattctaagaccaacggcttctag

DBGET integrated database retrieval system