KEGG   Candidatus Koribacter versatilis: Acid345_2544Help
Entry
Acid345_2544      CDS       T00352                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00010  Glycolysis / Gluconeogenesis
aba00051  Fructose and mannose metabolism
aba00562  Inositol phosphate metabolism
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01120  Microbial metabolism in diverse environments
aba01130  Biosynthesis of antibiotics
aba01200  Carbon metabolism
aba01230  Biosynthesis of amino acids
Module
aba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aba_M00002  Glycolysis, core module involving three-carbon compounds
aba_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid345_2544
   00051 Fructose and mannose metabolism
    Acid345_2544
   00562 Inositol phosphate metabolism
    Acid345_2544
Enzymes [BR:aba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acid345_2544
Exosome [BR:aba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Acid345_2544
  Exosomal proteins of bladder cancer cells
   Acid345_2544
  Exosomal proteins of melanoma cells
   Acid345_2544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABF41545
JGI: Acid3452544
UniProt: Q1INK5
Position
3004898..3005650
Genome map
AA seq 250 aa AA seqDB search
MSRKKIIAGNWKMHNTPQQSLAFVKAFLPLVADHTRDEIVLCPPYLSLATVVEATKGSNV
MVGAQNMHWEVKGAFTGECSPEMLVESGVTHVIIGHSERRQYFNETDDTVNRKLEVALEH
GLTPIVCVGEVLEEREAGLTEDVLRRQCSRAFRGISGKKAAKLVMAYEPVWAIGTGKTAT
PEIAEDAHLVIRGEAAKAFGDDFAHALRIQYGGSVKADNARTLMSQPDIDGALVGGASLD
AAGFAKIVKY
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtaagaagatcattgccggtaattggaagatgcataacacgccgcagcaatcg
ctggcgttcgtaaaggcgtttctgccgctggtggcagaccacacgcgcgatgagatcgtg
ctttgcccgccctacctttcactggcaaccgtggttgaagcaaccaagggatcgaatgtc
atggtcggcgcgcagaacatgcactgggaggtaaaaggcgcgttcaccggtgagtgctcg
cctgagatgctggttgagagcggcgtgacccacgtgattatcggccactcggaacgccgc
cagtatttcaacgagaccgacgacaccgtcaaccgcaagctcgaggtcgccctcgagcac
gggctcacgcccatcgtctgcgtcggcgaagtcctcgaagagcgtgaagccggcctcacc
gaagacgtccttcgccgccagtgctcgcgtgccttccgcggcatctccggcaagaaagca
gccaagctcgtcatggcgtacgaaccggtgtgggcgatcggtaccggcaagaccgcaacc
cccgaaattgccgaagatgcccacctcgtaattcgtggcgaagcagccaaagcattcggc
gacgattttgcgcacgcgctccgtatccagtatggcggcagcgtgaaagctgacaatgcg
cgtaccttgatgtcgcagccggacatcgacggggcgctcgtcggtggagcgagcctggac
gccgcgggcttcgcgaaaatcgtgaagtactaa

DBGET integrated database retrieval system