KEGG   Candidatus Koribacter versatilis: Acid345_2544Help
Entry
Acid345_2544      CDS       T00352                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid345_2544 (tpiA)
   01230 Biosynthesis of amino acids
    Acid345_2544 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid345_2544 (tpiA)
   00051 Fructose and mannose metabolism
    Acid345_2544 (tpiA)
   00562 Inositol phosphate metabolism
    Acid345_2544 (tpiA)
Enzymes [BR:aba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acid345_2544 (tpiA)
Exosome [BR:aba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Acid345_2544 (tpiA)
  Exosomal proteins of bladder cancer cells
   Acid345_2544 (tpiA)
  Exosomal proteins of melanoma cells
   Acid345_2544 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3004898..3005650
Genome map
AA seq 250 aa AA seqDB search
MSRKKIIAGNWKMHNTPQQSLAFVKAFLPLVADHTRDEIVLCPPYLSLATVVEATKGSNV
MVGAQNMHWEVKGAFTGECSPEMLVESGVTHVIIGHSERRQYFNETDDTVNRKLEVALEH
GLTPIVCVGEVLEEREAGLTEDVLRRQCSRAFRGISGKKAAKLVMAYEPVWAIGTGKTAT
PEIAEDAHLVIRGEAAKAFGDDFAHALRIQYGGSVKADNARTLMSQPDIDGALVGGASLD
AAGFAKIVKY
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtaagaagatcattgccggtaattggaagatgcataacacgccgcagcaatcg
ctggcgttcgtaaaggcgtttctgccgctggtggcagaccacacgcgcgatgagatcgtg
ctttgcccgccctacctttcactggcaaccgtggttgaagcaaccaagggatcgaatgtc
atggtcggcgcgcagaacatgcactgggaggtaaaaggcgcgttcaccggtgagtgctcg
cctgagatgctggttgagagcggcgtgacccacgtgattatcggccactcggaacgccgc
cagtatttcaacgagaccgacgacaccgtcaaccgcaagctcgaggtcgccctcgagcac
gggctcacgcccatcgtctgcgtcggcgaagtcctcgaagagcgtgaagccggcctcacc
gaagacgtccttcgccgccagtgctcgcgtgccttccgcggcatctccggcaagaaagca
gccaagctcgtcatggcgtacgaaccggtgtgggcgatcggtaccggcaagaccgcaacc
cccgaaattgccgaagatgcccacctcgtaattcgtggcgaagcagccaaagcattcggc
gacgattttgcgcacgcgctccgtatccagtatggcggcagcgtgaaagctgacaatgcg
cgtaccttgatgtcgcagccggacatcgacggggcgctcgtcggtggagcgagcctggac
gccgcgggcttcgcgaaaatcgtgaagtactaa

DBGET integrated database retrieval system