KEGG   Candidatus Koribacter versatilis: Acid345_2791Help
Entry
Acid345_2791      CDS       T00352                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00010  Glycolysis / Gluconeogenesis
aba00020  Citrate cycle (TCA cycle)
aba00620  Pyruvate metabolism
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01120  Microbial metabolism in diverse environments
aba01130  Biosynthesis of antibiotics
aba01200  Carbon metabolism
Module
aba_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid345_2791
   00020 Citrate cycle (TCA cycle)
    Acid345_2791
   00620 Pyruvate metabolism
    Acid345_2791
Enzymes [BR:aba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Acid345_2791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N NQRA HlyD_D23 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ABF41792
JGI: Acid3452791
UniProt: Q1IMV8
Position
complement(3303505..3305352)
Genome map
AA seq 615 aa AA seqDB search
MAQEFKLPELGENIASGDLVRVMVKPGDTVKEGQPVIELETDKAVIEVPSTVSGKVQEVK
VQKGQKLKVGAIIFTYGDGAAAAPVQPAAPAKTEDKPKAEPKAEAPKQAAPSAAKPAAST
GTKQTIEFKLPELGENIKQGQLVRIIAKQGASVSDGQPILELETDKAVIEVPATLTGTIK
EVHVKEGDKIGVGQTIFTVETTEGNTQPPHPHTNTEGNTQPPTGGGASSNTEGNTQPPHP
HSNTEGNPQPPTGGGGSSSATAARDFELSGQQLARLQFELALRSEGKTEREAHPPDVRDL
GVRVSLTPLTPGRPTVAASPTVRRLAREIGVDIVQVKGTGPGGRISEGDVKLFAKQLIVR
LQHEAATAKAAPKVVLPDFSKWGSIEKEQMRSIRRKTAERLTQAWTTIPHVTQHDRADIT
ELEKLREKFAKQAEAAGGKLTVTAIALKVIAAAMKKFPKFNASIDIDREEIIYKKYVHIG
VAVDTEAGLLVPVLRNVDQKNVYQIAAEMNELSKRARERKLKPEEMEGGTFTITNLGGIG
GTSFTPIVNLPEVAILGLSRGRTEPVWVNDHFEPRTMLPLSLSYDHRIIDGADAARYLRW
VADALEQPVLLLLQG
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaggaatttaaactccccgaactgggtgagaatattgccagcggcgacctggtt
cgtgtgatggtgaagcccggcgacaccgtcaaggaaggccagcctgtgatcgaactcgag
acggacaaggccgtcatcgaagttccttccaccgtcagcggcaaggtacaggaagtcaaa
gtccaaaaaggccagaagctgaaagtcggcgccatcatcttcacctatggcgacggcgcg
gccgccgccccggtgcagcccgcggctcctgcaaagaccgaagacaaacccaaggccgag
cctaaggctgaagcacccaagcaagctgcgccttctgctgcaaaacctgccgcgagcacc
ggcacaaaacaaacgatcgagttcaagcttccggaactaggcgagaacataaagcaaggc
cagctcgtccgcatcatcgctaagcaaggtgcgagtgtcagcgacggccaaccgatcctc
gaacttgaaaccgacaaagctgtcatcgaagttcccgccacattgaccggcaccatcaaa
gaagtgcatgtgaaggaaggcgacaagatcggcgttggccaaacgatcttcaccgtcgaa
accaccgagggtaacacccagccgccacatccacacaccaacaccgagggcaacacgcaa
ccgcccaccggcggcggcgcttcctcgaacacggaaggcaatactcagcccccgcatccg
cactccaacaccgaaggcaatccacagccgcccactggcggcggtggatcttcttccgcg
accgctgctcgcgacttcgaactcagcggacagcaacttgctcgccttcagttcgaactc
gctctgcgcagcgaaggcaaaaccgaacgcgaggcgcatccgcccgacgttcgtgatctt
ggcgtgcgggtctctctcacgccactgacgccgggccgtcccactgtcgccgcgtcgccc
acggtacgccgtctcgctcgcgaaatcggcgtcgacatcgtgcaggtgaagggaaccggt
cccggcggacgcatcagcgaaggggatgtaaagctcttcgcaaagcaactgatcgtgcgc
ctccagcacgaagccgctaccgcgaaggccgctcccaaggtcgtgctccccgacttcagc
aagtggggctcgatcgagaaagagcagatgcgcagcattcggcgcaaaactgctgagcgt
ctcacgcaggcctggaccaccatcccgcacgttactcagcacgaccgcgctgatatcacc
gagctcgaaaagctgcgcgagaagttcgcgaagcaagccgaagccgcgggtggcaagctc
acagtcacggccatcgcgctcaaagtcattgctgccgcgatgaagaagttccccaagttc
aacgcgtccatcgatatcgatcgcgaagaaattatctataagaagtacgtgcacatcggc
gtcgccgttgacactgaagccggactcctcgttcccgtacttcgcaacgtggaccagaaa
aacgtctatcagatcgcggccgagatgaacgaactctcgaagcgcgcgcgcgaacgcaag
ctcaagccggaagagatggaaggtggcaccttcaccatcaccaacctcggtggcattggc
ggcacatcattcacgccgatcgtgaacctccccgaggttgccatcctgggcctctcgcgc
ggacgcactgagcccgtgtgggtcaacgatcacttcgagccccggacgatgctcccgctc
tcgctcagctacgaccaccgcatcattgatggtgccgacgccgcccgctaccttcgctgg
gtcgctgacgcgctcgaacaaccggtgctgctgctcctgcaaggttga

DBGET integrated database retrieval system