KEGG   Candidatus Koribacter versatilis: Acid345_2807Help
Entry
Acid345_2807      CDS       T00352                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acid345_2807
Enzymes [BR:aba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Acid345_2807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3326581..3329025
Genome map
AA seq 814 aa AA seqDB search
MDDHIEEKVAFGAPGMEPRWTRGAKDAVGTAYSTSSKVWYTLAGGCITEIYYPTIDTPQV
RDVQFLVSDGETFCDEERRHMCADIDHVAEAALGYDVVSRDRSGRYTLKKTVLGDPHQNC
LLVRTELLPSPQFKDKLRLFVLAAPHMGIGGWHNNAEVHEFKGRRFLVAHKDGFWMAIGA
TIPFLKCSVGYVGASDGWTDIKDDYAMDWEFESAPDGNVAMTGQFDLSHGTEFTMGIAFG
RTLHSAVTSLINSICAPFDRVLTNFITQWARTAKRFDLIKNGLKPHNAHLFEHSVNLLLA
SEDKTYPGAMIASPAIPWGEDKGDDELGGYHLVWTRDMVNSASALLAVGDLGTPLRALIY
LAVSQRDDGGFYQNFWINGDPYWHGVQLDEVSFPIVLAWRLWKANALNQFDPYPLVKRAA
GYVIREGPYSPQERWEEAGGYSPSTLAISIAALVCAADFMSARGEPELATFVLQYADFLE
QHVERWTVTTEGSLLPGIPTHYIRINPANLANGFIDENPNTGTLRMANQEPGTQYDYPSK
DVVDAGFLELVRYGIRAAGSRLMEDSLRVIDAVLKVDTPQGPAWHRYNHDGFGQRDDGGS
YNYWGVGRVWPLLTGERGHYELAAGRDAELYHDTMANFSHGVGLLPEQVWDSPSLPKKHI
EFGGPTGAAIPLMWAHAEYLKLSRSIEDGRVFDLIEPVSDRYQSASYNPEPLEIWKLNRQ
IRSVPANTKVRLLASAPFQLHWSAENWATVNDSPSTKTDLGVHYVDVVIAGDPHDPLRFT
FYWTAESRWEGKDYELAVEARPVEAGRKAAHGVQ
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
gtggacgatcacattgaggagaaagtggcattcggtgctccgggcatggaaccccgctgg
acgcgtggcgcgaaggacgctgtcggcacagcctattccacgtcgagcaaagtctggtac
acactcgccggcggatgcattaccgagatttactaccctacgattgatacccctcaagta
cgcgatgtgcaattcctcgtaagcgacggggaaaccttttgcgacgaagagcgccgccac
atgtgtgctgacatcgaccatgtggccgaagcagccttgggatacgacgtagtcagccgc
gatcggagtggccggtacacgctaaagaagaccgtcctcggtgatccgcaccaaaactgc
ctgctggtgcgaaccgaactcctgcccagcccgcaattcaaggacaaactccgacttttt
gtgctggccgcaccgcatatgggaattggcgggtggcataacaatgctgaagtccacgaa
tttaaaggacgccgctttctggttgcgcacaaagacggattctggatggcaatcggtgcg
acgattccttttctcaagtgctcggttggctatgtgggcgcgagcgatggctggaccgac
atcaaagacgactatgcgatggactgggagtttgagtcggctcccgacggcaatgtggca
atgaccggtcagttcgatttgagccacggcaccgagttcacaatgggcatcgccttcgga
cgcacactgcattcagcggtgacgtctctcatcaactctatctgtgcgccgtttgaccgg
gttctgacgaatttcattacccagtgggctcgtactgctaagcgcttcgacctgatcaag
aacggattgaagccgcataacgcgcacctcttcgaacatagcgtgaacctgctgctggcg
agcgaagataagacctatcccggcgcgatgatcgcgtctcccgcaattccgtggggcgaa
gacaaaggcgacgacgaactcggcgggtatcacctggtgtggacgcgcgacatggtcaac
tccgcgtcggcactgctcgccgtaggggacctcggaacaccgctccgggcgttaatttac
ctggcggtttcccaacgcgatgacggcggtttctaccagaatttctggatcaacggcgat
ccgtactggcatggtgtgcaactcgacgaggtctcttttcccatcgtgctcgcctggcgc
ttgtggaaggcgaacgcgctgaaccagttcgatccgtatccactcgtaaagcgggcagcg
ggctatgttattcgcgagggaccctattctccgcaggagcgctgggaagaggcgggcggg
tattctccttcgaccttagcgatcagcatcgccgctctggtttgcgcggcagatttcatg
agcgcgcgcggtgaacccgaactggccacattcgttttgcagtatgccgacttcctcgag
cagcacgtcgaacgctggacggtgaccaccgaaggatcgctgttgcccggaatcccgacg
cattacatacggatcaatccggcaaacttggccaatggcttcattgacgagaacccgaat
accggcacgctgcgaatggccaaccaggaaccgggcacccagtacgactatccgtcgaaa
gatgtggtggatgccggtttcctggagctggtgcgctacggcattcgcgcagcgggttcg
aggctgatggaagactctctgcgggtgatcgacgcagtcctgaaggttgacacgccacaa
ggcccggcctggcaccgctacaaccatgacggcttcggccagcgcgacgatggcggatcg
tacaactactggggtgtcgggcgtgtgtggcccttgctgaccggtgaacgtggacattac
gagctcgccgcgggacgcgatgccgagctctaccacgacaccatggccaacttcagtcac
ggcgtcgggcttctccccgaacaggtttgggattctcccagcctgccgaagaaacacatc
gagttcggtggaccaaccggagcggccattccgctcatgtgggcgcacgccgagtacctg
aagctttcacgctccattgaggacggacgcgtcttcgaccttatagaaccagtatccgac
cgctatcaatcggcatcgtataacccagaacccttagaaatctggaaactcaaccgccaa
attcggtcggttccagccaataccaaagtccgacttctagcaagtgctccttttcaatta
cattggagtgctgagaattgggcgactgtaaacgacagtccgtccaccaagactgacctg
ggagtccactacgtagatgtcgtgatcgcgggcgatccgcacgatccgctccgcttcacc
ttctactggaccgccgagagccgatgggaaggcaaagattacgaactagcagtggaggcc
cgccccgtggaagcgggcagaaaggcagcacacggtgtccagtga

DBGET integrated database retrieval system