KEGG   Candidatus Koribacter versatilis: Acid345_2987Help
Entry
Acid345_2987      CDS       T00352                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Acid345_2987
Enzymes [BR:aba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Acid345_2987
Exosome [BR:aba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acid345_2987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3537316..3538812
Genome map
AA seq 498 aa AA seqDB search
MRLPYILALDQGTTSSRAIVFDQDGVVRSVAQREFTQIFPQAGWVEHDPEEIWASQISVA
VEALSRAELRSRHVAAIAITNQRETAVVWDRETGRPVYNAIVWQDRRTAGFCDQLKAAGH
EEFVQQRTGLLIDSYFSGSKVRWILDNVPQARSLAERGRLAFGTVDSWLIWKLTSGKLHI
TDVSNASRTMLFNIHTCQWDEELLRLLEIPASMLPEVRSSSEVYGTVQTSLGLESIPIAG
IAGDQQASLFGQRCTSPGMAKNTYGTGCFMLQNTGERAVPTSNRLVTTVAWKIGDVVEYA
LEGSVFIGGAVVQWLRDGLRLVRSSGEFQELANSVKDNGGVYVVPAFVGLGAPHWDQYAR
GGIFGITRGTTDGHVARAALESIAYQVADLLDAMQRDTGVPLPELRVDGGAAANETLLQF
QADIMGVPVVRPSVTETTALGAAFLAGIAVGLWSDPQVIAKMPVEQKRFEPRMGSAEALA
LRHQWEKALSRVKGWEEA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtttgccatacatccttgctctcgaccaggggaccacgagttcgcgcgccattgtg
ttcgatcaggatggagtggtgcgttcggtggcgcagcgcgagttcacgcagatctttccg
caagcaggatgggtggagcacgacccggaagaaatttgggcgtcgcagatcagcgtggca
gtggaggcgctgagccgggcggaacttcgctcgcgtcacgtggcggcgatcgccattact
aaccagcgcgagactgccgtggtgtgggaccgcgaaaccgggaggcccgtttataacgcg
attgtttggcaggaccggcggacggccggattctgcgatcagctgaaagccgcggggcac
gaggagtttgtgcagcaacgcactgggctgctcattgactcttacttttcggggagcaag
gtacggtggattctcgacaacgttccgcaagcaagaagcctggcggagcgcggacggctg
gcgttcggcaccgtagacagctggctgatctggaagctgacgagcgggaagctacacatc
accgacgtgagcaatgcttcgcgaacgatgctgtttaacattcacacctgccaatgggac
gaggaactgctgaggctgctggagattccggcatcgatgctgccggaggtgcggtcgtcg
agcgaagtgtatgggacggtgcagacgagcctggggctggaatcgattccgattgcgggg
attgcgggcgatcagcaggcatcattgtttggacagagatgcacttccccggggatggcg
aagaacacgtacgggaccggctgcttcatgctgcagaacacgggcgaacgcgcggtgccg
acgtcgaaccggctggtgacgaccgtggcgtggaagattggcgacgttgtggagtatgcg
cttgagggcagcgtgttcatcggcggcgcggtagtgcagtggctgcgcgatggattgcgg
ctggtgcggagttctggcgaattccaggagctggcgaattccgtgaaggacaatggtggc
gtttacgtggtgccggcgtttgtcggactcggtgcgccgcactgggaccagtatgcgcgg
ggcgggattttcggaattacgcgcgggacaaccgacggacatgtcgcgcgcgcggcgctg
gagagtattgcgtaccaggtggccgacctgttggacgcgatgcagcgcgataccggtgtg
ccactgccggagcttcgcgtggatggtggagcggcagcgaacgagacgctgttgcagttc
caggcggacattatgggggtgccggtggttcggccgtcggtgacggaaacgaccgcgctg
ggtgcggcttttctcgcgggcatcgcggtgggattgtggagcgatcctcaggtcatcgcg
aagatgccagtggaacaaaaacggttcgagcctcgcatggggagtgcggaagcgctggcg
ctgcgacaccagtgggagaaggcgctgtcgagggttaagggatgggaagaagcgtag

DBGET integrated database retrieval system