KEGG   Candidatus Koribacter versatilis: Acid345_3044Help
Entry
Acid345_3044      CDS       T00352                                 

Definition
molecular chaperone GroES
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
aba  Candidatus Koribacter versatilis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Acid345_3044
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid345_3044
  Lipid metabolism
   00071 Fatty acid degradation
    Acid345_3044
  Amino acid metabolism
   00350 Tyrosine metabolism
    Acid345_3044
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Acid345_3044
   00626 Naphthalene degradation
    Acid345_3044
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Acid345_3044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3615673..3616689
Genome map
AA seq 338 aa AA seqDB search
MAKMRAVQIAAAHGAFELVERDIPQPGAREVRIKVQACGVCHSDSVVKEGIMPTSYPRVP
GHEVVGVIDALGKDVPRWKVGDRVGVGWNGGYCGYCDNCRRGDFFACTSGPFITGLTSDG
GYADYMIARPEALALVPTDLSPEDAAPLMCAGVTTYNCLRNSGAIPGDLVAVLGIGGLGH
LAVQYAAKSGYRTAAIARGADKAALAKQLGAHHYIDTEKEDPSKALQTLGGAKVILSTVT
AADAMEATLGGLAIRGKFFLIGAVPSMKINPLQMLTFRQGVEGWYSGTSIDSQDTLNFSV
LENVRSMNEVYPLEKAAEGYERMLSGKARFRVVLKTGN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatgcgtgctgttcaaattgctgcggcccatggcgcattcgaacttgtcgaa
cgtgatatccctcaacccggtgcccgcgaagtgcgaatcaaagtgcaggcttgcggcgtc
tgccatagcgattcagtcgtaaaagaaggcatcatgccgaccagctatccgcgcgttccc
ggccacgaagttgtgggcgtgattgatgccctcggcaaagacgtgccgcgctggaaggtt
ggcgaccgagttggcgttggctggaatggcggctactgcggctattgcgacaactgtcgt
cgtggcgatttcttcgcctgcacttcgggcccgttcatcaccggactgacctcagatggc
ggttacgcggactacatgatcgcccgccccgaagcgcttgccctcgtgcccacagatctc
tcaccggaagacgctgcccctctgatgtgtgctggcgtcaccacctacaactgcttgcgc
aacagcggcgccataccgggtgatctcgtcgctgtcctcggcatcggcgggctcggccat
ctcgcggtgcagtacgcagcgaaatctggctatcgcaccgcggccatcgcgcgcggtgcc
gacaaagctgcgctcgcgaaacaactcggtgcgcatcattacatcgacaccgagaaagaa
gatccgtctaaggctttgcaaacgctcggcggcgcgaaggtgatcctctccactgttacc
gcagccgatgctatggaagcgactctcggcggactcgccattcgcggcaagttcttcctg
attggcgcagtgccctcgatgaagatcaatccactccagatgctcacgttccgccagggc
gtggaaggttggtattcgggaacgtcgattgattcgcaggacacgctgaacttcagcgtg
ctcgagaacgtccggtcaatgaatgaggtctatccgctggagaaagccgccgaaggctat
gagcgaatgctgagcggcaaagcgcgtttccgcgtcgtgctaaaaacaggaaattaa

DBGET integrated database retrieval system